Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

1376, CPT2

Enzyme Number

2.3.1.21

RLRdb entry

RL00236

Organisms

Human (9606)

Synonyms

CPT1|CPTASE;
CPT2;
carnitine palmitoyltransferase II;
OTTHUMP00000010493

Description

carnitine palmitoyltransferase II

Xrefs

HGNC:2330| MIM:600650| Ensembl:ENSG00000157184| HPRD:02802

Chromosome

1 : 1p32

Links to iHOP

1376

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

1376 155971 PMID: 11095714

Sequence Information

Nucleotide sequence

>1376 : length: 1977
atggtgccccgcctgctgctgcgcgcctggccccggggccccgcggttggtccgggagcc
cccagtcggcccctcagcgccggctccgggcccggccagtacctgcagcgcagcatcgtg
cccaccatgcactaccaggacagcctgcccaggctgcctattcccaaacttgaagacacc
attaggagatacctcagtgcacagaagcctctcttgaatgatggccagttcaggaaaaca
gaacaattttgcaagagttttgaaaatgggattggaaaagaactgcatgagcagctggtt
gctctggacaaacagaataaacatacaagctacatttcgggaccctggtttgatatgtac
ctatctgctcgagactccgttgttctgaactttaatccatttatggctttcaatcctgac
ccaaaatctgagtataatgaccagctcacccgggcaaccaacatgactgtttctgccatc
cggtttctgaagacactccgggctggccttctggagccagaagtgttccacttgaaccct
gcaaaaagtgacactatcaccttcaagagactcatacgctttgtgccttcctctctgtcc
tggtatggggcctacctggtcaatgcgtatcccctggatatgtcccagtattttcggctt
ttcaactcaactcgtttacccaaacccagtcgggatgaactcttcactgatgacaaggcc
agacacctcctggtcctaaggaaaggaaatttttatatctttgatgtcctggatcaagat
gggaacattgtgagcccctcggaaatccaggcacatctgaagtacattctctcagacagc
agccccgcccccgagtttcccctggcatacctgaccagtgagaaccgagacatctgggca
gagctcaggcagaagctgatgagtagtggcaatgaggagagcctgaggaaagtggactcg
gcagtgttctgtctctgcctagatgacttccccattaaggaccttgtccacttgtcccac
aatatgctgcatggggatggcacaaaccgctggtttgataaatcctttaacctcattatc
gccaaggatggctctactgccgtccactttgagcactcttggggtgatggtgtggcagtg
ctcagattttttaatgaagtatttaaagacagcactcagacccctgccgtcactccacag
agccagccagctaccactgactctactgtcacggtgcagaaactcaacttcgagctgact
gatgccttaaagactggcatcacagctgctaaggaaaagtttgatgccaccatgaaaacc
ctcactattgactgcgtccagtttcagagaggaggcaaagaattcctgaagaagcaaaag
ctgagccctgacgcagttgcccagctggcattccagatggccttcctgcggcagtacggg
cagacagtggccacctacgagtcctgtagcactgccgcattcaagcacggccgcactgag
accatccgcccggcctccgtctatacaaagaggtgctctgaggcctttgtcagggagccc
tccaggcacagtgctggtgagcttcagcagatgatggttgagtgctccaagtaccatggc
cagctgaccaaagaagcagcaatgggccagggctttgaccgacacttgtttgctctgcgg
catctggcagcagccaaagggatcatcttgcctgagctctacctggaccctgcatacggg
cagataaaccacaatgtcctgtccacgagcacactgagcagcccagcagtgaaccttggg
ggctttgcccctgtggtctctgatggctttggtgttgggtatgctgttcatgacaactgg
ataggctgcaatgtctcttcctacccaggccgcaatgcccgggagtttctccaatgtgtg
gagaaggccttagaagacatgtttgatgccttagaaggcaaatccatcaaaagttaa

Protein sequence

>1376 : length: 658
MVPRLLLRAWPRGPAVGPGAPSRPLSAGSGPGQYLQRSIVPTMHYQDSLPRLPIPKLEDT
IRRYLSAQKPLLNDGQFRKTEQFCKSFENGIGKELHEQLVALDKQNKHTSYISGPWFDMY
LSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHLNP
AKSDTITFKRLIRFVPSSLSWYGAYLVNAYPLDMSQYFRLFNSTRLPKPSRDELFTDDKA
RHLLVLRKGNFYIFDVLDQDGNIVSPSEIQAHLKYILSDSSPAPEFPLAYLTSENRDIWA
ELRQKLMSSGNEESLRKVDSAVFCLCLDDFPIKDLVHLSHNMLHGDGTNRWFDKSFNLII
AKDGSTAVHFEHSWGDGVAVLRFFNEVFKDSTQTPAVTPQSQPATTDSTVTVQKLNFELT
DALKTGITAAKEKFDATMKTLTIDCVQFQRGGKEFLKKQKLSPDAVAQLAFQMAFLRQYG
QTVATYESCSTAAFKHGRTETIRPASVYTKRCSEAFVREPSRHSAGELQQMMVECSKYHG
QLTKEAAMGQGFDRHLFALRHLAAAKGIILPELYLDPAYGQINHNVLSTSTLSSPAVNLG
GFAPVVSDGFGVGYAVHDNWIGCNVSSYPGRNAREFLQCVEKALEDMFDALEGKSIKS



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min