Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

14583, Gfpt1

Enzyme Number

2.6.1.16

RLRdb entry

RL00454

Organisms

Mouse (10090)

Synonyms

AI324119|GFA|GFAT|GFAT1|GFAT1m|Gfpt;
Gfpt1;
glutamine fructose-6-phosphate transaminase 1;
OTTMUSP00000026384|glutamine:fructose-6-phosphate amidotransferase 1

Description

glutamine fructose-6-phosphate transaminase 1

Xrefs

MGI:95698| Ensembl:ENSMUSG00000029992

Chromosome

6 : 6 D1|6 35.5 cM

Links to iHOP

14583

Sequence Information

Nucleotide sequence

>14583 : length: 2046
atgtgcggtatatttgcttatttaaattaccatgttcctcgaacaagacgagaaatcttg
gagacactaatcaaaggccttcagagactggaatacagaggatatgattctgctggtgtg
ggacttgacggaggcaatgacaaagactgggaagccaacgcctgcaaaatccagctcatt
aagaagaaaggaaaagttaaggcactggatgaagaagttcacaaacaacaagatatggac
ttggatatagaatttgatgtgcatcttggaatagctcatacccgttgggcgacacatgga
gaacccaatcctgtcaatagtcacccccagcgctctgataaaaataatgaattcattgtt
attcataatggaatcatcaccaactacaaagacttgaaaaagtttctggaaagcaaaggc
tatgactttgaatctgaaacagacacagaaaccattgccaagctcgtcaagtacatgtat
gacaactgggagagccaggacgtcagttttaccaccttggtggagagagttatccaacaa
ttggaaggcgcctttgctcttgtgtttaaaagtgtccattttcccgggcaagcagttggc
acaaggcgaggtagccctctcttgattggtgtgcggagtgaacataagctttctacagat
cacattccgattctgtacagaacaggcaaagacaagaaaggaagctgcggtctttcccgt
gtggacagcacgacatgcctgttccctgttgaggaaaaggcagttgaatattactttgct
tctgatgcaagtgccgtgatagagcacaccaatcgtgtcatctttctggaagatgatgat
gttgcagcagtggtggatggccgtctctctatccaccgaattaaacgaactgcaggagac
catcctggccgagctgtgcaaactctccagatggagctccagcagatcatgaagggcaac
tttagttcatttatgcagaaggaaatttttgagcagccagaatctgttgtgaacacaatg
agaggaagagtcaattttgatgactacactgtgaatttgggaggtttgaaagatcacatt
aaggagatccagcggtgtcggcggttgattcttattgcttgtggcacaagttaccacgct
ggtgtggcaacccgtcaggtcctggaggagctgaccgagctgcccgtgatggtggagctt
gccagtgacttcttggatagaaacactccagtctttcgagatgatgtttgctttttcatt
agtcaatcaggcgagacagctgacaccctgatgggacttcgttactgtaaggagagagga
gccttaactgtggggatcacaaatacagtcggcagttctatatcaagggagacagattgc
ggggttcatattaatgctggtcctgagattggcgtggccagtacaaaggcatacaccagc
cagtttgtgtccctcgtgatgtttgctctcatgatgtgtgatgacaggatctccatgcaa
gagagacgcaaagagatcatgctcggactgaagcgactgccggacttgattaaggaagtg
ctgagcatggatgatgaaatccagaagctggcgacggagctttaccaccagaagtcggtc
ctgataatggggcggggctaccattatgctacatgccttgaaggggctctgaaaatcaag
gagattacttatatgcattcggaaggcatccttgctggtgagctcaagcacggccctctg
gccttggtggacaagttgatgcctgtcatcatgatcatcatgcgagaccacacttatgcc
aagtgccagaacgctcttcagcaggtggttgcacggcaggggcgtccagtcgtgatctgt
gataaggaggatactgagaccattaagaatacaaaaaggacaatcaaggtgccccactca
gtggactgcttgcagggcattctcagtgtgattcccctgcagctgctggctttccacctg
gctgtgctgagaggctacgatgttgattttccacggaatcttgccaaatctgtaacagta
gagtaa

Protein sequence

>14583 : length: 681
MCGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGLDGGNDKDWEANACKIQLI
KKKGKVKALDEEVHKQQDMDLDIEFDVHLGIAHTRWATHGEPNPVNSHPQRSDKNNEFIV
IHNGIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDNWESQDVSFTTLVERVIQQ
LEGAFALVFKSVHFPGQAVGTRRGSPLLIGVRSEHKLSTDHIPILYRTGKDKKGSCGLSR
VDSTTCLFPVEEKAVEYYFASDASAVIEHTNRVIFLEDDDVAAVVDGRLSIHRIKRTAGD
HPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHI
KEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFI
SQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTS
QFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSV
LIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYA
KCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHL
AVLRGYDVDFPRNLAKSVTVE



Basic Information

Gene ID

14584, Gfpt2

Enzyme Number

2.6.1.16

RLRdb entry

RL00454

Organisms

Mouse (10090)

Synonyms

RP23-10G21.7;
AI480523|GFAT2;
Gfpt2;
glutamine fructose-6-phosphate transaminase 2;
OTTMUSP00000005729

Description

glutamine fructose-6-phosphate transaminase 2

Xrefs

MGI:1338883| Ensembl:ENSMUSG00000020363

Chromosome

11 : 11 B1.2|11 26.0 cM

Links to iHOP

14584

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

14584 18747 PMID: 15133036

Sequence Information

Nucleotide sequence

>14584 : length: 2049
atgtgcggaatctttgcctacatgaattacagagttcccaagacgaggaaagagattttc
gaaacccttatcaggggcctgcagcggctggagtacaggggctatgactctgcgggggtt
gccattgatgggaataaccacgaagtcaaagaaagacacatccatcttgtgaagaaaagg
gggaaagtaaaggctctggatgaagaactttacaagcaagatagcatggacttgaaggtg
gagtttgagacacacttcggcattgcccacacacgttgggccacccacggggttcccaat
gctgtcaacagtcacccgcagcgttcggacaaagacaatgaatttgttgtcatccacaac
gggatcatcactaattacaaggatctaaggaagtttctggaaagcaaaggctacgagttt
gagtcagaaacagacacggagaccatcgccaagctgattaaatatgtatttgacaacaga
gagactgaggacataacgttttccacattggtcgaaagagtcattcagcagttggaaggc
gcctttgcactggttttcaagagtattcactacccgggagaagctgtcgccacgaggaga
ggcagccccttgctcatcggggtacgaagcaaatacaaactctccacagagcagatcccc
gtcttatatccgacatgcaatatcgagaatgtgaagaatatctgcaagactaggatgaag
agactggacagctccacctgcctgcacgctgtgggcgataaagctgtggaattcttcttt
gcttctgatgcaagtgccatcatagaacacaccaaccgggtcatcttcttagaagatgat
gatatcgctgcagtggctgatgggaaactctccattcaccgagtcaagcgctcagctact
gatgacccctcccgagccatccagaccttgcagatggaactgcagcaaataatgaaaggt
aacttcagcgcatttatgcagaaggagatcttcgagcagccagaatcagtttttaatacc
atgagaggtcgggtgaattttgagaccaacacagtgctcctgggtggcttgaaggaccat
ttgaaagagatccgacgatgccgaaggctcattgtgattggctgtggaaccagctaccat
gccgctgtggctacacggcaagtcttagaggaactgaccgagctgcctgtgatggttgaa
cttgccagtgactttctggacaggaacacacctgtgttcagggatgacgtttgctttttc
ataagccaatcaggtgagactgcagacacgctcctggcgctgcgatactgtaaggatcga
ggtgcgctgaccgtgggcatcaccaacaccgtgggtagctccatctcccgggagactgac
tgtggcgtccacatcaacgcagggcccgagattggggtggccagcaccaaggcgtacacc
agccagttcatctctctggtgatgtttggtttgatgatgtctgaagatcgaatttctcta
cagaacaggagacaagagatcatccgtggcctcagatctttaccggagctgatcaaagaa
gtgctgtccctggatgagaagatccatgacttggccctggagctctacacacaaaggtct
ctcctcgtgatgggacggggatataactatgccacatgtctggaaggtgccttgaaaatt
aaggagataacctacatgcactcagaaggtatcctagccggagagctgaagcacgggccc
cttgctctcgtcgacaagcagatgccagtcatcatggtcatcatgaaggatccttgcttt
gccaagtgccagaatgccctgcagcaggtcactgcccgccagggtcgcccaatcatactg
tgttccaaggatgacaccgagagctccaagtttgcatataaaaccattgaacttccccac
acagtggactgtctccagggtatcctgagcgtgattccactccagcttctgtccttccac
ctggctgtcctccgaggttatgatgttgacttccccagaaacctagccaagtctgtcact
gtggaatga

Protein sequence

>14584 : length: 682
MCGIFAYMNYRVPKTRKEIFETLIRGLQRLEYRGYDSAGVAIDGNNHEVKERHIHLVKKR
GKVKALDEELYKQDSMDLKVEFETHFGIAHTRWATHGVPNAVNSHPQRSDKDNEFVVIHN
GIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEG
AFALVFKSIHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPVLYPTCNIENVKNICKTRMK
RLDSSTCLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSAT
DDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDH
LKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFF
ISQSGETADTLLALRYCKDRGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYT
SQFISLVMFGLMMSEDRISLQNRRQEIIRGLRSLPELIKEVLSLDEKIHDLALELYTQRS
LLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKQMPVIMVIMKDPCF
AKCQNALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH
LAVLRGYDVDFPRNLAKSVTVE



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min