Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

15275, Hk1

Enzyme Number

2.7.1.1

RLRdb entry

RL00508

Organisms

Mouse (10090)

Synonyms

BB404130|Hk-1|Hk1-s|dea|mHk1-s;
Hk1;
hexokinase 1;
downeast anemia

Description

hexokinase 1

Xrefs

MGI:96103| Ensembl:ENSMUSG00000037012

Chromosome

10 : 10 B4|10 30.0 cM

Links to iHOP

15275

Sequence Information

Nucleotide sequence

>15275 : length: 2838
atgggacagaactgccagcgaggacaggctgtagatgttgaaccaaaaatacgaccccct
ctcacagaggaaaagattgataagtatctgtatgccatgcggctctctgatgaaattctg
atagatatcctgacacgcttcaagaaagagatgaagaatggcctctcccgggattataac
ccaacggcctccgtcaagatgctgccaacctttgtccggtccattccggacggctcagaa
aagggggatttcattgcactggatctcggcgggtcttcctttcgaatcctgcgggtgcag
gtgaaccacgagaagagtcagaacgtcagcatggagtctgaggtctacgacaccccagag
aacatcgtgcacggcagtggaagccagctttttgatcacgtcgctgaatgcctcggagac
ttcatggagaaaaggaagatcaaggacaagaaattacccgtgggattcacgttttccttc
ccgtgccgacaatccaaaatagacgaggccgtactgatcacgtggacaaagcggttcaaa
gccagtggcgtggaaggggcggatgtggtcaagctgctgaataaagccattaagaagcga
ggggactatgacgctaacattgtagctgtggtgaatgacacagtggggaccatgatgacc
tgcggctacgatgaccaacagtgtgaagtcggcctgatcattggcactggcaccaatgct
tgctacatggaggaactgcgacacatcgacctggtggaaggcgatgaggggaggatgtgt
attaacacggaatggggagcctttggggatgatgggtccctggaagacattcgaacagag
tttgacagagagttagaccggggatccctcaaccctgggaaacagctgttcgagaagatg
gtgagcggcatgtacatgggggagctggtccggctgatcctggtgaagatggccaaggaa
agcctcttatttgaagggcgcattactccagagctgctcacgaggggcaagttcaccact
agcgacgtagccgccattgaaacgggatgggaactctcccctgaccgcaggtggtaccag
gcatatatgaggtgcacacaagacacccacagggataaggaaggcgttcaaaatgccaag
gaaatcttgacccgcctgggagtggagccgtctcacgatgactgcgtatcggtccagcac
gtatgcacgatcgtctccttccgatcagccaacctggtggctgccacgctcggtgccatc
ttgaaccgcctgcgggacaataagggcacgcccaggctgcggaccacagttggcgtagac
ggttctctctacaagatgcacccacagtattcccggcggttccacaagaccctgaggcgc
ctggtgcctgactcggacgtccggttcctcctctcggagagtggcagtggcaagggagcc
gccatggtgaccgctgtggcctaccgcctggccgagcagcaccggcagattgaggaaacc
ctgtcccacttccgcctcagcaagcaggcactgatggaggtgaagaagaagctgcggtca
gagatggaaatggggctgagaaaggagaccaacagcagagctacggtcaaaatgctgcct
tcttatgtgcggagcatcccagatgggactgagcatggtgacttcctggccttggatctc
ggaggaacgaatttccgagtcctactggtaaagatccgtagtgggaaaaagagaacagtg
gagatgcacaacaagatctactccattcccctggaaatcatgcagggcaccggggatgag
ctgtttgatcacattgtctcctgcatctccgacttcctggactacatggggatcaaaggc
ccccggatgcctctgggcttcaccttctcgtttccctgcaagcagacgagcctagattgc
ggaatcttgatcacgtggacaaagggattcaaagccaccgactgtgtgggtcacgatgta
gccactttactgagggatgctgtaaaaaggagagaggaatttgacctggatgtggtggct
gtggtcaacgacaccgtgggcaccatgatgacttgtgcttatgaagaaccttcttgtgag
attggactcatcgtggggactggcagcaatgcctgctacatggaggagatgaaaaacgtg
gagatggtggaggggaaccagggccagatgtgcatcaatatggaatggggtgcctttggt
gacaacggctgtctggacgacatcagaacagacttcgacaaagtggtggacgaatattct
ctaaacagtgggaaacaaaggtttgagaagatgatcagtggaatgtacctgggtgagatc
gtccgtaacatcctgattgacttcaccaagaaaggcttcctcttccggggacagatctct
gagccactcaagacccgaggcatcttcgagaccaagtttctctctcagatcgagagtgac
cgattagcgctgctccaggtgcgggccatccttcagcagctgggtctaaacagcacgtgc
gacgacagtatcctggtcaagaccgtgtgtggggtggtgtccaagcgggcggcccagctg
tgtggtgccggcatggccgccgtggtgcaaaagatccgagagaacagaggcctagaccac
ctgaatgtaaccgtgggcgtggacgggacgctctacaaactccatccacacttctccaga
atcatgcaccaaacagtgaaggaactgtcaccaaagtgtaccgtgtccttcctcctgtct
gaagacggcagcggcaagggggccgcccttatcacagctgtgggcgtgcggctcagagga
gaccctacgaacgcctaa

Protein sequence

>15275 : length: 945
MGQNCQRGQAVDVEPKIRPPLTEEKIDKYLYAMRLSDEILIDILTRFKKEMKNGLSRDYN
PTASVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKSQNVSMESEVYDTPE
NIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCRQSKIDEAVLITWTKRFK
ASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNA
CYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRELDRGSLNPGKQLFEKM
VSGMYMGELVRLILVKMAKESLLFEGRITPELLTRGKFTTSDVAAIETGWELSPDRRWYQ
AYMRCTQDTHRDKEGVQNAKEILTRLGVEPSHDDCVSVQHVCTIVSFRSANLVAATLGAI
LNRLRDNKGTPRLRTTVGVDGSLYKMHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGA
AMVTAVAYRLAEQHRQIEETLSHFRLSKQALMEVKKKLRSEMEMGLRKETNSRATVKMLP
SYVRSIPDGTEHGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYSIPLEIMQGTGDE
LFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCKQTSLDCGILITWTKGFKATDCVGHDV
ATLLRDAVKRREEFDLDVVAVVNDTVGTMMTCAYEEPSCEIGLIVGTGSNACYMEEMKNV
EMVEGNQGQMCINMEWGAFGDNGCLDDIRTDFDKVVDEYSLNSGKQRFEKMISGMYLGEI
VRNILIDFTKKGFLFRGQISEPLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTC
DDSILVKTVCGVVSKRAAQLCGAGMAAVVQKIRENRGLDHLNVTVGVDGTLYKLHPHFSR
IMHQTVKELSPKCTVSFLLSEDGSGKGAALITAVGVRLRGDPTNA



Basic Information

Gene ID

15277, Hk2

Enzyme Number

2.7.1.1

RLRdb entry

RL00508

Organisms

Mouse (10090)

Synonyms

AI642394|HKII;
Hk2;
hexokinase 2;
-

Description

hexokinase 2

Xrefs

MGI:1315197| Ensembl:ENSMUSG00000000628

Chromosome

6 : 6 C3|6 34.5 cM

Links to iHOP

15277

Sequence Information

Nucleotide sequence

>15277 : length: 2754
atgatcgcctcgcatatgatcgcctgcttattcacggagctcaaccaaaaccaagtgcag
aaggttgaccagtatctctaccacatgcgtctctcagatgagacccttctggagatttct
aggcggttccggaaggagatggagaaggggctaggagctaccacacaccctacagcagct
gtgaagatgctgcccacctttgtgaggtcaactccggatgggacagaacatggcgagttc
ctggctctggaccttggaggaaccaacttccgtgtgctccgagtaagggtgacagacaat
ggtctccagagggtggagatggagaaccagatctacgccattcccgaggacatcatgcgg
ggcagtggaacccagctgtttgaccacattgccgaatgcctggccaacttcatggacaag
ctacagatcaaagagaagaagctcccgctgggtttcaccttctcgttcccctgccaccag
acgaaactggatgagagtttcttggtctcatggactaaggggttcaagtccagtggcgtg
gaaggcagagatgtggtggatctgatccggaaggccatccagcgcagaggggactttgac
attgacattgtggctgtggtgaatgacacggttgggaccatgatgacttgtggttatgat
gatcagaactgcgagattggtctcattgtgggtactggcagtaatgcctgctacatggag
gagatgcgtcacattgacatggtggagggcgacgagggacggatgtgcatcaacatggag
tggggggcctttggggacgacggtacactcaatgacatccgaactgagtttgacagagag
atcgacatgggctcactgaaccctgggaagcagctgtttgagaagatgatcagcgggatg
tacatgggggagctggtcagactcatcctggtgaagatggccaaggccgagctgctgttc
caagggaaactcagcccagagctccttaccactggctccttcgagaccaaagatgtctcg
gatattgaagacgataaggacggaattcagaaggcctaccagatcctggtgcgcctgggt
ctgagcccgctgcaggaggactgtgtggccacgcaccgaatctgccagattgtgtccacg
cgctcagccagcctgtgtgcagccaccctggccgcggtgctgtggcggatcaaagagaac
aagggcgaggagcgactccgctccaccatcggcgtggatggctctgtctacaagaaacat
ccccattttgccaagcgtctccataaggcagtgaggaggctggtgcccgattgtgatgtc
cgcttcctccgctctgaggatggcagcggcaagggggcggctatggtgacggcggtggct
taccgtctggctgaccaacaccgggcccgccagaagaccctggagtctctgaagctgagc
catgaacagctgctggaggttaagagaaggatgaaggtggaaatggagcagggtctgagc
aaggagacgcatgaggccgcccctgtgaagatgttgcccacttatgtgtgtgccactcca
gacggtacagagaaaggagacttcctggccttggatcttggaggaacaaacttccgggtc
ctgctggtgcgcgtgcgtaatggcaagcgaaggggcgtagagatgcataacaagatctac
tccatcccacaggaagtcatgcatggcactggagaagagcttttcgaccacattgtccag
tgcatcgcggacttccttgagtacatgggcatgaagggcgtgtccctacctttgggtttc
accttctccttcccttgccagcagaacagcctggaccagagcatcctcctcaagtggaca
aagggattcaaggcatccggctgcgagggtgaagatgtggtcaccttgctgaaggaagcc
attcgccggcgagaggagtttgacctggatgtggtggccgtggtaaatgacacagttggg
actatgatgacttgtggctatgaagaccctcactgtgaagttggcctcattgttggcact
ggaagcaatgcctgctacatggaggagatgcgtaatgtggaactggtggacggagaggag
gggcggatgtgtgtcaacatggagtggggagcgttcggggacaacggctgcctggatgac
ctgcgcacagtgtttgacgtcgctgtggacgagctctctctcaaccctggcaaacagagg
tttgagaagatgatcagcggcatgtacttgggcgagattgtgcgcaacatcctgatcgat
ttcacaaagcgggggctgctcttccgtggccgcatctcagagcgcctcaagacaagggga
atcttcgaaactaagttcctgtctcagatcgagagtgactgcctggccctgctacaggtc
cgagccatcttgcgccacctagggctggagagcacgtgtgacgacagcatcattgtgaag
gaggtgtgcactgtggtcgcccggcgcgcggcccagctctgtggcgcaggcatggccgcc
gtggtggacaagataagagagaaccgtggactggacaacctcaaagtgacggtgggcgtg
gacgggacactgtacaagcttcatcctcactttgccaaagtcatgcatgagacggtgaga
gatctggctccgaaatgtgacgtgtccttcctggaatccgaggacggcagtgggaaggga
gcggctctcatcactgctgtggcctgtcgcatccgggaggccgggcagagatag

Protein sequence

>15277 : length: 917
MIASHMIACLFTELNQNQVQKVDQYLYHMRLSDETLLEISRRFRKEMEKGLGATTHPTAA
VKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLRVRVTDNGLQRVEMENQIYAIPEDIMR
GSGTQLFDHIAECLANFMDKLQIKEKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGV
EGRDVVDLIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDQNCEIGLIVGTGSNACYME
EMRHIDMVEGDEGRMCINMEWGAFGDDGTLNDIRTEFDREIDMGSLNPGKQLFEKMISGM
YMGELVRLILVKMAKAELLFQGKLSPELLTTGSFETKDVSDIEDDKDGIQKAYQILVRLG
LSPLQEDCVATHRICQIVSTRSASLCAATLAAVLWRIKENKGEERLRSTIGVDGSVYKKH
PHFAKRLHKAVRRLVPDCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTLESLKLS
HEQLLEVKRRMKVEMEQGLSKETHEAAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRV
LLVRVRNGKRRGVEMHNKIYSIPQEVMHGTGEELFDHIVQCIADFLEYMGMKGVSLPLGF
TFSFPCQQNSLDQSILLKWTKGFKASGCEGEDVVTLLKEAIRRREEFDLDVVAVVNDTVG
TMMTCGYEDPHCEVGLIVGTGSNACYMEEMRNVELVDGEEGRMCVNMEWGAFGDNGCLDD
LRTVFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRG
IFETKFLSQIESDCLALLQVRAILRHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAA
VVDKIRENRGLDNLKVTVGVDGTLYKLHPHFAKVMHETVRDLAPKCDVSFLESEDGSGKG
AALITAVACRIREAGQR



Basic Information

Gene ID

212032, Hk3

Enzyme Number

2.7.1.1

RLRdb entry

RL00508

Organisms

Mouse (10090)

Synonyms

MGC143940;
Hk3;
hexokinase 3;
-

Description

hexokinase 3

Xrefs

MGI:2670962| Ensembl:ENSMUSG00000025877

Chromosome

13 : 13 B1

Links to iHOP

212032

Sequence Information

Nucleotide sequence

>212032 : length: 2769
atggccaccattgggccttctggcctgcatcctggagaaagagcctcagtctgcccacac
gagggcgtgccaaggccctcaggtagcttagaactggaatgcttgcagcaattcaaggtg
accaggacacagttgcagcagatccaagccagtctcctgtgctccatggagcaggcactg
aagggacaggacagtcccgctccttctgtccggatgctgcccacatacgtgaggtccaca
ccacacggcaccgagcaaggggatttcctggtgctggagctgggggccacaggagcatca
ctacgtgtgttgtgggtaacactgacaggcaccaaagaatgccgggtggagcccaggagc
cgggagtttgtgattcctcaagaggtgatcctaggtgctggccagcagctctttgacttt
gctgcccgatgcctctctgaattcctggatgcataccccgtggagaatcagggtctgaag
cttgggttcaatttctcttttccttgtcaccagacaggcttggacaggagcaccctcatt
tcctggacaaaaggttttaggtgcagcggcgtggaaggccaggatgtggtccagttgcta
agagatgccattcagaggcaggggacctacaggattgatgtggtagccatggtgaatgac
acggtgggcaccatgatgggctgtgagctgggcaccaggccgtgtgaagtcgggctgatt
gtagacaccggtaccaacgcgtgctacatggaggaggcgcggcacgtggccgctctggat
gaggaccgcggccgcacctgtgtcagcatcgagtggggctccttctatgacgaagatgct
ctagggccagtactgaccaccttcgactctgccctggaccgcgagtccctgactcctggt
gctcaaaggtttgagaagatgattggaggcctttacctgggtgagctggtgaggctggtt
ctggtccacttgacccagcacggggtcctctttgatggctgcgcctctcctgcgttgctg
agtcaaggctgtatcctcctggaccacgtggctgagatggaggacaccgccactgggaca
gcccgcgtccacaccatcctgcaggacttgggtctgagccctcgggcctcagatgctgaa
ctggtgcaatatgtgtgcgtggctgtgtgcacacgggctgcccagctctgtgcggctgcc
ctggctgcagtcctctcccgcctccagcacagcagggagcagcagacattgcaagtggct
gtggccactggagggcgagtgtttgaacgacaccccaggttcctccgaatcctaaaggag
acggtaacactcctggccccaaactgtgatgtctccttcatcccctctgtggatggtggt
ggccggggtgtggcaatggtgacagctgtggctgcccgcctggctgctcacaggcgcatc
ctggaagagaccctggcaccatttcagctgaccttggagcagatgacagtggtgcaggca
caaatgcgggaagccatgatcagggggcttcaaggagaggcctcctccctccgcatgctg
cccacttacgtccgagcgacgcccgacggcagcgagcgaggtgatttcctggccttggac
ctagggggcaccaacttccgggtcctgttggtacgagtggcggagggcagtgtgcagatc
atcaaccaggtctactccattcctgagtgtagagcccagggctctggacagaagctcttt
gaccatattgtggactgcatcgtggacttccagaagaggcagggccttagtggacagagc
ctacccctgggtttcaccttctctttcccatgcaagcagcttggcctggaccagggcatc
ctcctgaattggactaaggggttcaatgcatcaggctgtgagggccaggatgttgtgtat
ctattacgggaagccattaggcgcagacaggcagtggagctgaatgtggttgccattgtc
aatgacacggtggggaccatgatgtcctgtggctatgatgatccccgttgtgagatgggc
ctcattgtcggaaccggcaccaacgcctgttacatggaagagctccgcaatgtggcaagt
gtgcctggggactcgggcctcatgtgcatcaacatggagtggggtgcctttggggatgat
ggctcactgggcacactcagcacccgctttgacaccagtgtggaccaggcatccatcaat
ccaggcaaacagaggtttgagaaaatgatcagcggtatgtacttgggggagatcgtccgc
catatcctcctgcacttaaccaatctcggagttctcttccgaggccagaagactcaatgc
cttcaggccagggacatcttcaagactaagttcctctctgagatcgaaagtgatagcctg
gccctgcgtcaggtccgagccatcctggaagatctggggctgactctgacatctgatgac
gccttgatggtcctggaagtgtgccaggctgtgtctcgcagggctgcccaactctgtggg
gcaggtgtggctgccgtggtggagaagattcgggagaaccggggcctgcaggagctgaca
gtgtctgtgggagtagatgggacactctacaagctacatcctcacttctccaagctggtg
tcggcaacagtccggaagctagcccctcagtgcaccgtcacctttttgcagtcggaggat
gggtctggcaaaggcgcagctttggttactgctgttgcttgtcgccttacccagatggcc
cacgtctga

Protein sequence

>212032 : length: 922
MATIGPSGLHPGERASVCPHEGVPRPSGSLELECLQQFKVTRTQLQQIQASLLCSMEQAL
KGQDSPAPSVRMLPTYVRSTPHGTEQGDFLVLELGATGASLRVLWVTLTGTKECRVEPRS
REFVIPQEVILGAGQQLFDFAARCLSEFLDAYPVENQGLKLGFNFSFPCHQTGLDRSTLI
SWTKGFRCSGVEGQDVVQLLRDAIQRQGTYRIDVVAMVNDTVGTMMGCELGTRPCEVGLI
VDTGTNACYMEEARHVAALDEDRGRTCVSIEWGSFYDEDALGPVLTTFDSALDRESLTPG
AQRFEKMIGGLYLGELVRLVLVHLTQHGVLFDGCASPALLSQGCILLDHVAEMEDTATGT
ARVHTILQDLGLSPRASDAELVQYVCVAVCTRAAQLCAAALAAVLSRLQHSREQQTLQVA
VATGGRVFERHPRFLRILKETVTLLAPNCDVSFIPSVDGGGRGVAMVTAVAARLAAHRRI
LEETLAPFQLTLEQMTVVQAQMREAMIRGLQGEASSLRMLPTYVRATPDGSERGDFLALD
LGGTNFRVLLVRVAEGSVQIINQVYSIPECRAQGSGQKLFDHIVDCIVDFQKRQGLSGQS
LPLGFTFSFPCKQLGLDQGILLNWTKGFNASGCEGQDVVYLLREAIRRRQAVELNVVAIV
NDTVGTMMSCGYDDPRCEMGLIVGTGTNACYMEELRNVASVPGDSGLMCINMEWGAFGDD
GSLGTLSTRFDTSVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTNLGVLFRGQKTQC
LQARDIFKTKFLSEIESDSLALRQVRAILEDLGLTLTSDDALMVLEVCQAVSRRAAQLCG
AGVAAVVEKIRENRGLQELTVSVGVDGTLYKLHPHFSKLVSATVRKLAPQCTVTFLQSED
GSGKGAALVTAVACRLTQMAHV



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min