Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

1737, DLAT

Enzyme Number

2.3.1.12

RLRdb entry

RL00002

Organisms

Human (9606)

Synonyms

DLTA|PDC-E2|PDCE2;
DLAT;
dihydrolipoamide S-acetyltransferase;
70 kDa mitochondrial autoantigen of primary biliary cirrhosis|E2 component of pyruvate dehydrogenase complex|M2 antigen complex 70 kDa subunit

Description

dihydrolipoamide S-acetyltransferase

Xrefs

HGNC:2896| MIM:608770| Ensembl:ENSG00000150768| HPRD:10578

Chromosome

11 : 11q23.1

Links to iHOP

1737

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

1737 5160 PMID: 16189514
1737 5160 PMID: 14638692
1737 5164 PMID: 12816949
1737 5164 PMID: 16189514
1737 5163 PMID: 11978179
1737 5163 PMID: 16189514
1737 5166 PMID: 11978179
1737 5166 PMID: 16189514
1737 5165 PMID: 11978179
1737 5165 PMID: 16189514
1737 1738 PMID: 14638692
1737 5162 PMID: 16189514
1737 5162 PMID: 14638692
1737 8050 PMID: 16189514
1737 8050 PMID: 14638692

Sequence Information

Nucleotide sequence

>1737 : length: 1944
atgtggcgcgtctgtgcgcgacgggctcagaatgtagccccatgggcgggactcgaggct
cggtggacggccttgcaggaggtacccggaactccacgagtgacctcgcgatctggcccg
gctcccgctcgtcgcaacagcgtgactacagggtatggcggggtccgggcactgtgcggc
tggacccccagttctggggccacgccgcggaaccgcttactgctgcagcttttggggtcg
cccggccgccgctattacagtcttcccccgcatcagaaggttccattgccttctctttcc
cccacaatgcaggcaggcaccatagcccgttgggaaaaaaaagagggggacaaaatcaat
gaaggtgacctaattgcagaggttgaaactgataaagccactgttggatttgagagcctg
gaggagtgttatatggcaaagatacttgttgctgaaggtaccagggatgttcccatcgga
gcgatcatctgtatcacagttggcaagcctgaggatattgaggcctttaaaaattataca
ctggattcctcagcagcacctaccccacaagcggccccagcaccaacccctgctgccact
gcttcgccacctacaccttctgctcaggctcctggtagctcatatccccctcacatgcag
gtacttcttcctgccctctctcccaccatgaccatgggcacagttcagagatgggaaaaa
aaagtgggtgagaagctaagtgaaggagacttactggcagagatagaaactgacaaagcc
actataggttttgaagtacaggaagaaggttatctggcaaaaatcctggtccctgaaggc
acaagagatgtccctctaggaaccccactctgtatcattgtagaaaaagaggcagatata
tcagcatttgctgactataggccaaccgaagtaacagatttaaaaccacaagtgccacca
cctaccccacccccggtggccgctgttcctccaactccccagcctttagctcctacacct
tcagcaccctgcccagctactcctgctggaccaaagggaagggtgtttgttagccctctt
gcaaagaagttggcagtagagaaagggattgatcttacacaagtaaaagggacaggacca
gatggtagaatcaccaagaaggatatcgactcttttgtgcctagtaaagttgctcctgct
ccggcagctgttgtgcctcccacaggtcctggaatggcaccagttcctacaggtgtcttc
acagatatcccaatcagcaacattcgtcgggttattgcacagcgattaatgcaatcaaag
caaaccatacctcattattacctttctatcgatgtaaatatgggagaagttttgttggta
cggaaagaacttaataagatattagaagggagaagcaaaatttctgtcaatgacttcatc
ataaaagcttcagctttggcatgtttaaaagttcccgaagcaaattcttcttggatggac
acagttataagacaaaatcatgttgttgatgtcagtgttgcggtcagtactcctgcagga
ctcatcacacctattgtgtttaatgcacatataaaaggagtggaaaccattgctaatgat
gttgtttctttagcaaccaaagcaagagagggtaaactacagccacatgaattccagggt
ggcacttttacgatctccaatttaggaatgtttggaattaagaatttctctgctattatt
aacccacctcaagcatgtattttggcaattggtgcttcagaggataaactggtccctgca
gataatgaaaaagggtttgatgtggctagcatgatgtctgttacactcagttgtgatcac
cgggtggtggatggagcagttggagcccagtggcttgctgagtttagaaagtaccttgaa
aaacctatcactatgttgttgtaa

Protein sequence

>1737 : length: 647
MWRVCARRAQNVAPWAGLEARWTALQEVPGTPRVTSRSGPAPARRNSVTTGYGGVRALCG
WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIARWEKKEGDKIN
EGDLIAEVETDKATVGFESLEECYMAKILVAEGTRDVPIGAIICITVGKPEDIEAFKNYT
LDSSAAPTPQAAPAPTPAATASPPTPSAQAPGSSYPPHMQVLLPALSPTMTMGTVQRWEK
KVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADI
SAFADYRPTEVTDLKPQVPPPTPPPVAAVPPTPQPLAPTPSAPCPATPAGPKGRVFVSPL
AKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPAPAAVVPPTGPGMAPVPTGVF
TDIPISNIRRVIAQRLMQSKQTIPHYYLSIDVNMGEVLLVRKELNKILEGRSKISVNDFI
IKASALACLKVPEANSSWMDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGVETIAND
VVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAIGASEDKLVPA
DNEKGFDVASMMSVTLSCDHRVVDGAVGAQWLAEFRKYLEKPITMLL



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min