Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

1738, DLD

Enzyme Number

1.8.1.4

RLRdb entry

RL00002

RLRdb entry

RL00256

RLRdb entry

RL00295

Organisms

Human (9606)

Synonyms

tcag7.39;
DLDH|E3|GCSL|LAD|PHE3;
DLD;
dihydrolipoamide dehydrogenase;
E3 component of pyruvate dehydrogenase complex, 2-oxo-glutarate complex, branched chain keto acid dehydrogenase complex|diaphorase|dihydrolipoyl dehydrogenase|glycine cleavage system protein L|lipoamide dehydrogenase|lipoamide reductase|lipoyl dehydrogenase

Description

dihydrolipoamide dehydrogenase

Xrefs

HGNC:2898| MIM:238331| Ensembl:ENSG00000091140| HPRD:02006

Chromosome

7 : 7q31-q32

Links to iHOP

1738

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

1738 10295 PMID: 15576032
1738 4967 PMID: 9727038
1738 1737 PMID: 14638692

Sequence Information

Nucleotide sequence

>1738 : length: 1530
atgcagagctggagtcgtgtgtactgctccttggccaagagaggccatttcaatcgaata
tctcatggcctacagggactttctgcagtgcctctgagaacttacgcagatcagccgatt
gatgctgatgtaacagttataggttctggtcctggaggatatgttgctgctattaaagct
gcccagttaggcttcaagacagtctgcattgagaaaaatgaaacacttggtggaacatgc
ttgaatgttggttgtattccttctaaggctttattgaacaactctcattattaccatatg
gcccatggaaaagattttgcatctagaggaattgaaatgtccgaagttcgcttgaattta
gacaagatgatggagcagaagagtactgcagtaaaagctttaacaggtggaattgcccac
ttattcaaacagaataaggttgttcatgtcaatggatatggaaagataactggcaaaaat
caagtcactgctacgaaagctgatggcggcactcaggttattgatacaaagaacattctt
atagccacgggttcagaagttactccttttcctggaatcacgatagatgaagatacaata
gtgtcatctacaggtgctttatctttaaaaaaagttccagaaaagatggttgttattggt
gcaggagtaataggtgtagaattgggttcagtttggcaaagacttggtgcagatgtgaca
gcagttgaatttttaggtcatgtaggtggagttggaattgatatggagatatctaaaaac
tttcaacgcatccttcaaaaacaggggtttaaatttaaattgaatacaaaggttactggt
gctaccaagaagtcagatggaaaaattgatgtttctattgaagctgcttctggtggtaaa
gctgaagttatcacttgtgatgtactcttggtttgcattggccgacgaccctttactaag
aatttgggactagaagagctgggaattgaactagatcccagaggtagaattccagtcaat
accagatttcaaactaaaattccaaatatctatgccattggtgatgtagttgctggtcca
atgctggctcacaaagcagaggatgaaggcattatctgtgttgaaggaatggctggtggt
gctgtgcacattgactacaattgtgtgccatcagtgatttacacacaccctgaagttgct
tgggttggcaaatcagaagagcagttgaaagaagagggtattgagtacaaagttgggaaa
ttcccatttgctgctaacagcagagctaagacaaatgctgacacagatggcatggtgaag
atccttgggcagaaatcgacagacagagtactgggagcacatattcttggaccaggtgct
ggagaaatggtaaatgaagctgctcttgctttggaatatggagcatcctgtgaagatata
gctagagtctgtcatgcacatccgaccttatcagaagcttttagagaagcaaatcttgct
gcgtcatttggcaaatcaatcaacttttga

Protein sequence

>1738 : length: 509
MQSWSRVYCSLAKRGHFNRISHGLQGLSAVPLRTYADQPIDADVTVIGSGPGGYVAAIKA
AQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNL
DKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTATKADGGTQVIDTKNIL
IATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVT
AVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSIEAASGGK
AEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAGP
MLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGK
FPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDI
ARVCHAHPTLSEAFREANLAASFGKSINF



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min