Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

,

Enzyme Number

Organisms

()

Synonyms

;
;
;
;

Description

Xrefs

Chromosome

:

Links to iHOP

Sequence Information

Nucleotide sequence

>1892 : length: 

Protein sequence

>1892 : length: 



Basic Information

Gene ID

1962, EHHADH

Enzyme Number

1.1.1.35

RLRdb entry

RL00006

Organisms

Human (9606)

Synonyms

ECHD|LBFP|LBP|MGC120586|PBFE;
EHHADH;
enoyl-Coenzyme A, hydratase/3-hydroxyacyl Coenzyme A dehydrogenase;
3,2-trans-enoyl-CoA isomerase|L-bifunctional protein, peroxisomal

Description

enoyl-Coenzyme A, hydratase/3-hydroxyacyl Coenzyme A dehydrogenase

Xrefs

HGNC:3247| MIM:607037| Ensembl:ENSG00000113790| HPRD:06125

Chromosome

3 : 3q26.3-q28

Links to iHOP

1962

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

1962 6342 PMID: 10856712

Sequence Information

Nucleotide sequence

>1962 : length: 2172
atggccgagtatacgcggctgcacaacgccttggcgctaatccgcctccgaaacccgccg
gtcaacgcgatcagtacgactttactccgtgacataaaagaaggactacagaaagctgta
atagaccatacaataaaagccattgtgatttgtggagcagagggcaaattttctgcaggt
gctgatattcgtggcttcagtgctcctaggacatttggccttacactgggacatgtagta
gatgaaatacagagaaatgagaagcccgtggtggcagcaatccaaggcatggctttcgga
gggggactagagctggccctgggctgtcactataggattgcccacgcagaggctcaagtt
ggcttaccagaagttacactgggacttctccctggtgcaagaggaacccagcttctcccc
agactcactggagttcctgctgcacttgacttaattacctcaggaagacgtattttagca
gatgaagcactcaagctgggcattctagataaagttgtaaactcagacccggttgaagaa
gcaatcagatttgctcagagagtttcagatcaacctctagaatcccgtagactctgcaac
aagccaattcagagcttgcccaacatggacagcatttttagtgaggccctcttgaagatg
cggaggcagcaccctgggtgtcttgcacaggaggcttgtgtccgtgcagtccaggctgct
gtgcagtatccctatgaagtgggcatcaagaaggaggaggagctgtttctatatcttttg
caatcagggcaggctagagccctgcaatatgctttcttcgctgaaaggaaagcaaataag
tggtcaactccctccggagcatcgtggaaaacagcatcagcgcggcctgtctcctcagtt
ggtgttgttggcttgggaacaatgggccgaggcattgtcatttcttttgcaagggccagg
attcctgtgattgctgtagactcggacaaaaaccagctagcaactgcaaacaagatgata
acctctgtcttggaaaaagaagcctccaaaatgcaacagagcggccacccttggtcagga
ccaaaacccaggttaacttcatctgtgaaggagcttggtggtgtagatttagtcattgaa
gcagtatttgaggaaatgagcctgaagaagcaggtctttgctgaactctcagctgtgtgc
aaaccagaagcatttttgtgcactaatacttcagccctggatgttgatgagattgcttct
tccactgatcgtcctcacttggtcattggcacccacttcttttcgccagctcatgtcatg
aagttgttagaggttattcccagccaatactcttcccccactaccattgccactgttatg
aacttatcaaaaaagattaaaaagattggagtcgttgtaggcaactgttttggatttgtg
gggaatcgaatgttgaatccttactacaatcaggcatatttcttgttagaagaaggcagc
aaaccagaggaggtagatcaggtgctggaagagtttggttttaaaatgggaccttttaga
gtgtctgatcttgctgggttggatgtgggctggaaatctagaaaggggcaaggtcttact
ggacctacattgcttccaggaactcctgcccgaaaaaggggtaataggaggtactgccca
attcctgatgtgctctgtgaattaggacgatttggccagaagacaggtaagggttggtat
caatatgacaagccattgggtaggattcacaaacctgatccctggctttccaaattccta
tcacggtatagaaaaacccatcacattgaaccacgtaccattagccaggatgagatcctt
gaacgctgcttatattcacttatcaatgaagcattccgtatcttgggagaagggatagct
gctagcccagagcacattgatgttgtctatttacatggatatggatggccaaggcacaag
ggcgggcccatgttctatgcttccacagttgggttgcccacagttctagagaaattgcag
aaatattacaggcagaaccctgatattccccaactggagccaagtgactatctaaaaaaa
ctggcttctcagggaaaccctcccctgaaagaatggcaaagcttggcaggctcccctagc
agtaaattgtga

Protein sequence

>1962 : length: 723
MAEYTRLHNALALIRLRNPPVNAISTTLLRDIKEGLQKAVIDHTIKAIVICGAEGKFSAG
ADIRGFSAPRTFGLTLGHVVDEIQRNEKPVVAAIQGMAFGGGLELALGCHYRIAHAEAQV
GLPEVTLGLLPGARGTQLLPRLTGVPAALDLITSGRRILADEALKLGILDKVVNSDPVEE
AIRFAQRVSDQPLESRRLCNKPIQSLPNMDSIFSEALLKMRRQHPGCLAQEACVRAVQAA
VQYPYEVGIKKEEELFLYLLQSGQARALQYAFFAERKANKWSTPSGASWKTASARPVSSV
GVVGLGTMGRGIVISFARARIPVIAVDSDKNQLATANKMITSVLEKEASKMQQSGHPWSG
PKPRLTSSVKELGGVDLVIEAVFEEMSLKKQVFAELSAVCKPEAFLCTNTSALDVDEIAS
STDRPHLVIGTHFFSPAHVMKLLEVIPSQYSSPTTIATVMNLSKKIKKIGVVVGNCFGFV
GNRMLNPYYNQAYFLLEEGSKPEEVDQVLEEFGFKMGPFRVSDLAGLDVGWKSRKGQGLT
GPTLLPGTPARKRGNRRYCPIPDVLCELGRFGQKTGKGWYQYDKPLGRIHKPDPWLSKFL
SRYRKTHHIEPRTISQDEILERCLYSLINEAFRILGEGIAASPEHIDVVYLHGYGWPRHK
GGPMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPSDYLKKLASQGNPPLKEWQSLAGSPS
SKL



Basic Information

Gene ID

,

Enzyme Number

Organisms

()

Synonyms

;
;
;
;

Description

Xrefs

Chromosome

:

Links to iHOP

Sequence Information

Nucleotide sequence

>3030 : length: 

Protein sequence

>3030 : length: 



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min