Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

1962, EHHADH

Enzyme Number

1.1.1.35

RLRdb entry

RL00006

Organisms

Human (9606)

Synonyms

ECHD|LBFP|LBP|MGC120586|PBFE;
EHHADH;
enoyl-Coenzyme A, hydratase/3-hydroxyacyl Coenzyme A dehydrogenase;
3,2-trans-enoyl-CoA isomerase|L-bifunctional protein, peroxisomal

Description

enoyl-Coenzyme A, hydratase/3-hydroxyacyl Coenzyme A dehydrogenase

Xrefs

HGNC:3247| MIM:607037| Ensembl:ENSG00000113790| HPRD:06125

Chromosome

3 : 3q26.3-q28

Links to iHOP

1962

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

1962 6342 PMID: 10856712

Sequence Information

Nucleotide sequence

>1962 : length: 2172
atggccgagtatacgcggctgcacaacgccttggcgctaatccgcctccgaaacccgccg
gtcaacgcgatcagtacgactttactccgtgacataaaagaaggactacagaaagctgta
atagaccatacaataaaagccattgtgatttgtggagcagagggcaaattttctgcaggt
gctgatattcgtggcttcagtgctcctaggacatttggccttacactgggacatgtagta
gatgaaatacagagaaatgagaagcccgtggtggcagcaatccaaggcatggctttcgga
gggggactagagctggccctgggctgtcactataggattgcccacgcagaggctcaagtt
ggcttaccagaagttacactgggacttctccctggtgcaagaggaacccagcttctcccc
agactcactggagttcctgctgcacttgacttaattacctcaggaagacgtattttagca
gatgaagcactcaagctgggcattctagataaagttgtaaactcagacccggttgaagaa
gcaatcagatttgctcagagagtttcagatcaacctctagaatcccgtagactctgcaac
aagccaattcagagcttgcccaacatggacagcatttttagtgaggccctcttgaagatg
cggaggcagcaccctgggtgtcttgcacaggaggcttgtgtccgtgcagtccaggctgct
gtgcagtatccctatgaagtgggcatcaagaaggaggaggagctgtttctatatcttttg
caatcagggcaggctagagccctgcaatatgctttcttcgctgaaaggaaagcaaataag
tggtcaactccctccggagcatcgtggaaaacagcatcagcgcggcctgtctcctcagtt
ggtgttgttggcttgggaacaatgggccgaggcattgtcatttcttttgcaagggccagg
attcctgtgattgctgtagactcggacaaaaaccagctagcaactgcaaacaagatgata
acctctgtcttggaaaaagaagcctccaaaatgcaacagagcggccacccttggtcagga
ccaaaacccaggttaacttcatctgtgaaggagcttggtggtgtagatttagtcattgaa
gcagtatttgaggaaatgagcctgaagaagcaggtctttgctgaactctcagctgtgtgc
aaaccagaagcatttttgtgcactaatacttcagccctggatgttgatgagattgcttct
tccactgatcgtcctcacttggtcattggcacccacttcttttcgccagctcatgtcatg
aagttgttagaggttattcccagccaatactcttcccccactaccattgccactgttatg
aacttatcaaaaaagattaaaaagattggagtcgttgtaggcaactgttttggatttgtg
gggaatcgaatgttgaatccttactacaatcaggcatatttcttgttagaagaaggcagc
aaaccagaggaggtagatcaggtgctggaagagtttggttttaaaatgggaccttttaga
gtgtctgatcttgctgggttggatgtgggctggaaatctagaaaggggcaaggtcttact
ggacctacattgcttccaggaactcctgcccgaaaaaggggtaataggaggtactgccca
attcctgatgtgctctgtgaattaggacgatttggccagaagacaggtaagggttggtat
caatatgacaagccattgggtaggattcacaaacctgatccctggctttccaaattccta
tcacggtatagaaaaacccatcacattgaaccacgtaccattagccaggatgagatcctt
gaacgctgcttatattcacttatcaatgaagcattccgtatcttgggagaagggatagct
gctagcccagagcacattgatgttgtctatttacatggatatggatggccaaggcacaag
ggcgggcccatgttctatgcttccacagttgggttgcccacagttctagagaaattgcag
aaatattacaggcagaaccctgatattccccaactggagccaagtgactatctaaaaaaa
ctggcttctcagggaaaccctcccctgaaagaatggcaaagcttggcaggctcccctagc
agtaaattgtga

Protein sequence

>1962 : length: 723
MAEYTRLHNALALIRLRNPPVNAISTTLLRDIKEGLQKAVIDHTIKAIVICGAEGKFSAG
ADIRGFSAPRTFGLTLGHVVDEIQRNEKPVVAAIQGMAFGGGLELALGCHYRIAHAEAQV
GLPEVTLGLLPGARGTQLLPRLTGVPAALDLITSGRRILADEALKLGILDKVVNSDPVEE
AIRFAQRVSDQPLESRRLCNKPIQSLPNMDSIFSEALLKMRRQHPGCLAQEACVRAVQAA
VQYPYEVGIKKEEELFLYLLQSGQARALQYAFFAERKANKWSTPSGASWKTASARPVSSV
GVVGLGTMGRGIVISFARARIPVIAVDSDKNQLATANKMITSVLEKEASKMQQSGHPWSG
PKPRLTSSVKELGGVDLVIEAVFEEMSLKKQVFAELSAVCKPEAFLCTNTSALDVDEIAS
STDRPHLVIGTHFFSPAHVMKLLEVIPSQYSSPTTIATVMNLSKKIKKIGVVVGNCFGFV
GNRMLNPYYNQAYFLLEEGSKPEEVDQVLEEFGFKMGPFRVSDLAGLDVGWKSRKGQGLT
GPTLLPGTPARKRGNRRYCPIPDVLCELGRFGQKTGKGWYQYDKPLGRIHKPDPWLSKFL
SRYRKTHHIEPRTISQDEILERCLYSLINEAFRILGEGIAASPEHIDVVYLHGYGWPRHK
GGPMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPSDYLKKLASQGNPPLKEWQSLAGSPS
SKL



Basic Information

Gene ID

3028, HSD17B10

Enzyme Number

1.1.1.35

RLRdb entry

RL00006

Organisms

Human (9606)

Synonyms

RP3-339A18.2;
17b-HSD10|ABAD|CAMR|ERAB|HADH2|HCD2|MHBD|MRX17|MRX31|MRXS10|SCHAD;
HSD17B10;
hydroxysteroid (17-beta) dehydrogenase 10;
17-beta-hydroxysteroid dehydrogenase type 10|3-hydroxy-2-methylbutyryl-CoA dehydrogenase|AB-binding alcohol dehydrogenase|OTTHUMP00000023348|OTTHUMP00000023349|amyloid-beta binding polypeptide|amyloid-beta peptide binding alcohol dehydrogenase|mental retardation, X-linked, syndromic 11|short chain L-3-hydroxyacyl-CoA dehydrogenase type 2|short chain type dehydrogenase/reductase XH98G2|type 10 17b-HSD|type 10 17beta-hydroxysteroid dehydrogenase

Description

hydroxysteroid (17-beta) dehydrogenase 10

Xrefs

HGNC:4800| MIM:300256| Ensembl:ENSG00000072506| HPRD:02223

Chromosome

X : Xp11.2

Links to iHOP

3028

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

3028 351 PMID: 9338779
3028 351 PMID: 16189514
3028 351 PMID: 10371197

Sequence Information

Nucleotide sequence

>3028 : length: 759
atggcagcagcgtgtcggagcgtgaagggcctggtggcggtaataaccggaggagcctcg
ggcctgggcctggccacggcggagcgacttgtggggcagggagcctctgctgtgcttctg
gacctgcccaactcgggtggggaggcccaagccaagaagttaggaaacaactgcgttttc
gccccagccgacgtgacctctgagaaggatgtgcaaacagctctggctctagcaaaagga
aagtttggccgtgtggatgtagctgtcaactgtgcaggcatcgcggtggctagcaagacg
tacaacttaaagaagggccagacccataccttggaagacttccagcgagttcttgatgtg
aatctcatgggcaccttcaatgtgatccgcctggtggctggtgagatgggccagaatgaa
ccagaccagggaggccaacgtggggtcatcatcaacactgccagtgtggctgccttcgag
ggtcaggttggacaagctgcatactctgcttccaaggggggaatagtgggcatgacactg
cccattgctcgggatctggctcccataggtctgtttggcaccccactgctgaccagcctc
ccagagaaagtgtgcaacttcttggccagccaagtgcccttccctagccgactgggtgac
cctgctgagtatgctcacctcgtacaggccatcatcgagaacccattcctcaatggagag
gtcatccggctggatggggccattcgtatgcagccttga

Protein sequence

>3028 : length: 252
MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVF
APADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDV
NLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTL
PIARDLAPIGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGE
VIRLDGAIRMQP



Basic Information

Gene ID

3033, HADH

Enzyme Number

1.1.1.35

RLRdb entry

RL00006

Organisms

Human (9606)

Synonyms

HAD|HADH1|HADHSC|HHF4|M/SCHAD|MGC8392|SCHAD;
HADH;
hydroxyacyl-Coenzyme A dehydrogenase;
L-3-hydroxyacyl-Coenzyme A dehydrogenase|L-3-hydroxyacyl-Coenzyme A dehydrogenase, short chain

Description

hydroxyacyl-Coenzyme A dehydrogenase

Xrefs

HGNC:4799| MIM:601609| Ensembl:ENSG00000138796

Chromosome

4 : 4q22-q26

Links to iHOP

3033

Sequence Information

Nucleotide sequence

>3033 : length: 945
atggccttcgtcaccaggcagttcatgcgttccgtgtcctcctcgtccaccgcctcggcc
tcggccaagaagataatcgtcaagcacgtgacggtcatcggcggcgggctgatgggcgcc
ggcattgcccaggttgctgcagcaactggtcacacagtagtgttggtagaccagacagag
gacatcctggcaaaatccaaaaagggaattgaggaaagccttaggaaagtggcaaagaag
aagtttgcagaaaaccttaaggccggcgatgaatttgtggagaagaccctgagcaccata
gcgaccagcacggatgcagcctccgttgtccacagcacagacttggtggtggaagccatc
gtggagaatctgaaggtgaaaaacgagctcttcaaaaggctggacaagtttgctgctgaa
catacaatctttgccagcaacacttcctccttgcagattacaagcatagctaatgccacc
accagacaagaccgattcgctggcctccatttcttcaacccagtgcctgtcatgaaactt
gtggaggtcattaaaacaccaatgaccagccagaagacatttgaatctttggtagacttt
agcaaagccctaggaaagcatcctgtttcttgcaaggacactcctgggtttattgtgaac
cgcctcctggttccatacctcatggaagcaatcaggctgtatgaacgaggtgacgcatcc
aaagaagacattgacactgctatgaaattaggagccggttaccccatgggcccatttgag
cttctagattatgtcggactggatactacgaagttcatcgtggatgggtggcatgaaatg
gatgcagagaacccattacatcagcccagcccatccttaaataagctggtagcagagaac
aagttcggcaagaagactggagaaggattttacaaatacaagtga

Protein sequence

>3033 : length: 314
MAFVTRQFMRSVSSSSTASASAKKIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTE
DILAKSKKGIEESLRKVAKKKFAENLKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAI
VENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKL
VEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDAS
KEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAEN
KFGKKTGEGFYKYK



Basic Information

Gene ID

3295, HSD17B4

Enzyme Number

1.1.1.35

RLRdb entry

RL00006

Organisms

Human (9606)

Synonyms

DBP|MFE-2;
HSD17B4;
hydroxysteroid (17-beta) dehydrogenase 4;
17-beta-HSD IV|17-beta-hydroxysteroid dehydrogenase 4|17beta-estradiol dehydrogenase type IV|3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase|D-3-hydroxyacyl-CoA dehydratase|D-bifunctional protein, peroxisomal|beta-hydroxyacyl dehydrogenase|beta-keto-reductase|peroxisomal multifunctional protein 2

Description

hydroxysteroid (17-beta) dehydrogenase 4

Xrefs

HGNC:5213| MIM:601860| Ensembl:ENSG00000133835| HPRD:03514

Chromosome

5 : 5q21

Links to iHOP

3295

Sequence Information

Nucleotide sequence

>3295 : length: 2211
atgggctcaccgctgaggttcgacgggcgggtggtactggtcaccggcgcgggggcagga
ttgggccgagcctatgccctggcttttgcagaaagaggagcgttagttgttgtgaatgat
ttgggaggggacttcaaaggagttggtaaaggctccttagctgctgataaggttgttgaa
gaaataagaaggagaggtggaaaagcagtggccaactatgattcagtggaagaaggagag
aaggttgtgaagacagccctggatgcttttggaagaatagatgttgtggtcaacaatgct
ggaattctgagggatcgttcctttgctaggataagtgatgaagactgggatataatccac
agagttcatttgcggggttcattccaagtgacacgggcagcatgggaacacatgaagaaa
cagaagtatggaaggattattatgacttcatcagcttcaggaatatatggcaactttggc
caggccaattatagtgctgcaaagttgggtcttctgggccttgcaaattctcttgcaatt
gaaggcaggaaaagcaacattcattgtaacaccattgctcctaatgcgggatcacggatg
actcagacagttatgcctgaagatcttgtggaagccctgaagccagagtatgtggcacct
cttgtcctttggctttgtcacgagagttgtgaggagaatggtggcttgtttgaggttgga
gcaggatggattggaaaattacgctgggagcggactcttggagctattgtaagacaaaag
aatcacccaatgactcctgaggcagtcaaggctaactggaagaagatctgtgactttgag
aatgccagcaagcctcagagtatccaagaatcaactggcagtataattgaagttctgagt
aaaatagattcagaaggaggagtttcagcaaatcatactagtcgtgcaacgtctacagca
acatcaggatttgctggagctattggccagaaactccctccattttcttatgcttatacg
gaactggaagctattatgtatgcccttggagtgggagcgtcaatcaaggatccaaaagat
ttgaaatttatttatgaaggaagttctgatttctcctgtttgcccaccttcggagttatc
ataggtcagaaatctatgatgggtggaggattagcagaaattcctggactttcaatcaac
tttgcaaaggttcttcatggagagcagtacttagagttatataaaccacttcccagagca
ggaaaattaaaatgtgaagcagttgttgctgatgtcctagataaaggatccggtgtagtg
attattatggatgtctattcttattctgagaaggaacttatatgccacaatcagttctct
ctctttcttgttggctctggaggctttggtggaaaacggacatcagacaaagtcaaggta
gctgtagccatacctaatagacctcctgatgctgtacttacagataccacctctcttaat
caggctgctttgtaccgcctcagtggagactggaatcccttacacattgatcctaacttt
gctagtctagcaggttttgacaagcccatattacatggattatgtacatttggattttct
gccaggcgtgtgttacagcagtttgcagataatgatgtgtcaagattcaaggcaattaag
gctcgttttgcaaaaccagtatatccaggacaaactctacaaactgagatgtggaaggaa
ggaaacagaattcattttcaaaccaaggtccaagaaactggagacattgtcatttcaaat
gcatatgtggatcttgcaccaacatctggtacttcagctaagacaccctctgagggcggg
aagcttcagagtacctttgtatttgaggaaataggacgccgcctaaaggatattgggcct
gaggtggtgaagaaagtaaatgctgtatttgagtggcatataaccaaaggcggaaatatt
ggggctaagtggactattgacctgaaaagtggttctggaaaagtgtaccaaggccctgca
aaaggtgctgctgatacaacaatcatactttcagatgaagatttcatggaggtggtcctg
ggcaagcttgaccctcagaaggcattctttagtggcaggctgaaggccagagggaacatc
atgctgagccagaaacttcagatgattcttaaagactacgccaagctctga

Protein sequence

>3295 : length: 736
MGSPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVE
EIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIH
RVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAI
EGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVG
AGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLS
KIDSEGGVSANHTSRATSTATSGFAGAIGQKLPPFSYAYTELEAIMYALGVGASIKDPKD
LKFIYEGSSDFSCLPTFGVIIGQKSMMGGGLAEIPGLSINFAKVLHGEQYLELYKPLPRA
GKLKCEAVVADVLDKGSGVVIIMDVYSYSEKELICHNQFSLFLVGSGGFGGKRTSDKVKV
AVAIPNRPPDAVLTDTTSLNQAALYRLSGDWNPLHIDPNFASLAGFDKPILHGLCTFGFS
ARRVLQQFADNDVSRFKAIKARFAKPVYPGQTLQTEMWKEGNRIHFQTKVQETGDIVISN
AYVDLAPTSGTSAKTPSEGGKLQSTFVFEEIGRRLKDIGPEVVKKVNAVFEWHITKGGNI
GAKWTIDLKSGSGKVYQGPAKGAADTTIILSDEDFMEVVLGKLDPQKAFFSGRLKARGNI
MLSQKLQMILKDYAKL



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min