Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

20698, Sphk1

Enzyme Number

2.7.1.91

RLRdb entry

RL00415

Organisms

Mouse (10090)

Synonyms

RP23-193A16.4;
1110006G24Rik|SK1;
Sphk1;
sphingosine kinase 1;
OTTMUSP00000004201|OTTMUSP00000004202|OTTMUSP00000004203|OTTMUSP00000004204|OTTMUSP00000004205

Description

sphingosine kinase 1

Xrefs

MGI:1316649| Ensembl:ENSMUSG00000061878

Chromosome

11 : 11 E2

Links to iHOP

20698

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

20698 109652 PMID: 15196915

Sequence Information

Nucleotide sequence

>20698 : length: 1167
atgtggtggtgttgtgttttgtttgtagtagaatgccctcgaggactgctcccacggcca
tgcagagtgctggtgctgctgaacccccagggtggcaagggcaaggctctgcagctcttc
cagagccgtgtgcagcccttcctggaggaggcagagataacctttaaactgatactcacc
gaacggaagaaccatgccagggagctggtgtgtgcagaggagttgggtcactgggacgcc
ctggcagtcatgtccggtgatggtctgatgcatgaggtggtgaatgggctaatggaacgg
ccagactgggagactgccatccagaaacccctgtgtagcctccctggaggctccggcaat
gcgctggcagcttctgtgaaccactatgctgggtacgagcaggtgactaatgaagacctg
ctcatcaactgcacactgctgttgtgccgccggcgcctgtcacccatgaacctgctgtcc
ctgcacactgcttctgggctgcggctctattctgtgctcagtctgtcctggggctttgtt
gctgacgtggacctcgagagtgagaagtacaggcgcttgggggagattcgtttcacagtg
ggcaccttctttcgcctagcaagcctgcgcatctaccaaggccaactggcctaccttcct
gtaggaactgtggcctctaagagacccgcctctacactggtgcagaagggccccgtcgac
acacaccttgttcctctggaggagccagtgccttctcattggactgtggtaccagaacag
gacttcgtcctggtgctggtgctgctacacacccacctgagctccgagctgtttgcagca
cccatgggccgctgtgaggctggtgttatgcatctgttctacgtacgtgcgggggtgtca
agggctgcgctgctgcgcctcttcctggccatgcagaagggcaagcatatggaacttgac
tgtccatacctggttcatgtgcccgtggttgctttccgcctggagcccaggagccagagg
ggcgtgttttctgtggatggagagctgatggtatgtgaagctgtgcagggccaagtgcac
ccaaactacctttggatggtctgtggcagcagagatgccccatccggccgggactcccgg
cgggggccacctccagaagaaccataa

Protein sequence

>20698 : length: 388
MWWCCVLFVVECPRGLLPRPCRVLVLLNPQGGKGKALQLFQSRVQPFLEEAEITFKLILT
ERKNHARELVCAEELGHWDALAVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPGGSGN
ALAASVNHYAGYEQVTNEDLLINCTLLLCRRRLSPMNLLSLHTASGLRLYSVLSLSWGFV
ADVDLESEKYRRLGEIRFTVGTFFRLASLRIYQGQLAYLPVGTVASKRPASTLVQKGPVD
THLVPLEEPVPSHWTVVPEQDFVLVLVLLHTHLSSELFAAPMGRCEAGVMHLFYVRAGVS
RAALLRLFLAMQKGKHMELDCPYLVHVPVVAFRLEPRSQRGVFSVDGELMVCEAVQGQVH
PNYLWMVCGSRDAPSGRDSRRGPPPEEP



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min