Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

217, ALDH2

Enzyme Number

1.2.1.3

RLRdb entry

RL00062

Organisms

Human (9606)

Synonyms

ALDH-E2|ALDHI|ALDM|MGC1806;
ALDH2;
aldehyde dehydrogenase 2 family (mitochondrial);
ALDH class 2|acetaldehyde dehydrogenase 2|liver mitochondrial ALDH|mitochondrial aldehyde dehydrogenase 2|nucleus-encoded mitochondrial aldehyde dehydrogenase 2

Description

aldehyde dehydrogenase 2 family (mitochondrial)

Xrefs

HGNC:404| MIM:100650| Ensembl:ENSG00000111275| HPRD:00003

Chromosome

12 : 12q24.2

Links to iHOP

217

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

217 9094 PMID: 16169070
217 3692 PMID: 16169070
217 217 PMID: 16189514
217 11161 PMID: 16169070
217 84966 PMID: 16169070
217 54978 PMID: 16169070
217 3329 PMID: 16189514
217 3329 PMID: 12387818
217 1400 PMID: 16169070
217 3336 PMID: 12387818

Sequence Information

Nucleotide sequence

>217 : length: 1554
atgttgcgcgctgccgcccgcttcgggccccgcctgggccgccgcctcttgtcagccgcc
gccacccaggccgtgcctgcccccaaccagcagcccgaggtcttctgcaaccagattttc
ataaacaatgaatggcacgatgccgtcagcaggaaaacattccccaccgtcaatccgtcc
actggagaggtcatctgtcaggtagctgaaggggacaaggaagatgtggacaaggcagtg
aaggccgcccgggccgccttccagctgggctcaccttggcgccgcatggacgcatcacac
aggggccggctgctgaaccgcctggccgatctgatcgagcgggaccggacctacctggcg
gccttggagaccctggacaatggcaagccctatgtcatctcctacctggtggatttggac
atggtcctcaaatgtctccggtattatgccggctgggctgataagtaccacgggaaaacc
atccccattgacggagacttcttcagctacacacgccatgaacctgtgggggtgtgcggg
cagatcattccgtggaatttcccgctcctgatgcaagcatggaagctgggcccagccttg
gcaactggaaacgtggttgtgatgaaggtagctgagcagacacccctcaccgccctctat
gtggccaacctgatcaaggaggctggctttccccctggtgtggtcaacattgtgcctgga
tttggccccacggctggggccgccattgcctcccatgaggatgtggacaaagtggcattc
acaggctccactgagattggccgcgtaatccaggttgctgctgggagcagcaacctcaag
agagtgaccttggagctgggggggaagagccccaacatcatcatgtcagatgccgatatg
gattgggccgtggaacaggcccacttcgccctgttcttcaaccagggccagtgctgctgt
gccggctcccggaccttcgtgcaggaggacatctatgatgagtttgtggagcggagcgtt
gcccgggccaagtctcgggtggtcgggaacccctttgatagcaagaccgagcaggggccg
caggtggatgaaactcagtttaagaagatcctcggctacatcaacacggggaagcaagag
ggggcgaagctgctgtgtggtgggggcattgctgctgaccgtggttacttcatccagccc
actgtgtttggagatgtgcaggatggcatgaccatcgccaaggaggagatcttcgggcca
gtgatgcagatcctgaagttcaagaccatagaggaggttgttgggagagccaacaattcc
acgtacgggctggccgcagctgtcttcacaaaggatttggacaaggccaattacctgtcc
caggccctccaggcgggcactgtgtgggtcaactgctatgatgtgtttggagcccagtca
ccctttggtggctacaagatgtcggggagtggccgggagttgggcgagtacgggctgcag
gcatacactgaagtgaaaactgtcacagtcaaagtgcctcagaagaactcataa

Protein sequence

>217 : length: 517
MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPS
TGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA
ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPG
FGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADM
DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGP
QVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGP
VMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQS
PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS



Basic Information

Gene ID

218, ALDH3A1

Enzyme Number

1.2.1.3

RLRdb entry

RL00062

Organisms

Human (9606)

Synonyms

ALDH3|ALDHIII|MGC10406;
ALDH3A1;
aldehyde dehydrogenase 3 family, memberA1;
aldehyde dehydrogenase 3A1|aldehyde dehydrogenase isozyme 3|aldehyde dehydrogenase type III|aldehyde dehydrogenase, dimeric NADP-preferring|stomach aldehyde dehydrogenase

Description

aldehyde dehydrogenase 3 family, memberA1

Xrefs

HGNC:405| MIM:100660| Ensembl:ENSG00000108602| HPRD:00004

Chromosome

17 : 17p11.2

Links to iHOP

218

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

218 218 PMID: 12081471
218 218 PMID: 16189514

Sequence Information

Nucleotide sequence

>218 : length: 1362
atgagcaagatcagcgaggccgtgaagcgcgcccgcgccgccttcagctcgggcaggacc
cgtccgctgcagttccggatccagcagctggaggcgctgcagcgcctgatccaggagcag
gagcaggagctggtgggcgcgctggccgcagacctgcacaagaatgaatggaacgcctac
tatgaggaggtggtgtacgtcctagaggagatcgagtacatgatccagaagctccctgag
tgggccgcggatgagcccgtggagaagacgccccagactcagcaggacgagctctacatc
cactcggagccactgggcgtggtcctcgtcattggcacctggaactaccccttcaacctc
accatccagcccatggtgggcgccatcgctgcagggaactcagtggtcctcaagccctcg
gagctgagtgagaacatggcgagcctgctggctaccatcatcccccagtacctggacaag
gatctgtacccagtaatcaatgggggtgtccctgagaccacggagctgctcaaggagagg
ttcgaccatatcctgtacacgggcagcacgggggtggggaagatcatcatgacggctgct
gccaagcacctgacccctgtcacgctggagctgggagggaagagtccctgctacgtggac
aagaactgtgacctggacgtggcctgccgacgcatcgcctgggggaaattcatgaacagt
ggccagacctgcgtggcccctgactacatcctctgtgacccctcgatccagaaccaaatt
gtggagaagctcaagaagtcactgaaagagttctacggggaagatgctaagaaatcccgg
gactatggaagaatcattagtgcccggcacttccagagggtgatgggcctgattgagggc
cagaaggtggcttatgggggcaccggggatgccgccactcgctacatagcccccaccatc
ctcacggacgtggacccccagtccccggtgatgcaagaggagatcttcgggcctgtgctg
cccatcgtgtgcgtgcgcagcctggaggaggccatccagttcatcaaccagcgtgagaag
cccctggccctctacatgttctccagcaacgacaaggtgattaagaagatgattgcagag
acatccagtggtggggtggcggccaacgatgtcatcgtccacatcaccttgcactctctg
cccttcgggggcgtggggaacagcggcatgggatcctaccatggcaagaagagcttcgag
actttctctcaccgccgctcttgcctggtgaggcctctgatgaatgatgaaggcctgaag
gtcagataccccccgagcccggccaagatgacccagcactga

Protein sequence

>218 : length: 453
MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALQRLIQEQEQELVGALAADLHKNEWNAY
YEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNL
TIQPMVGAIAAGNSVVLKPSELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKER
FDHILYTGSTGVGKIIMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKFMNS
GQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRIISARHFQRVMGLIEG
QKVAYGGTGDAATRYIAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEEAIQFINQREK
PLALYMFSSNDKVIKKMIAETSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFE
TFSHRRSCLVRPLMNDEGLKVRYPPSPAKMTQH



Basic Information

Gene ID

219, ALDH1B1

Enzyme Number

1.2.1.3

RLRdb entry

RL00062

Organisms

Human (9606)

Synonyms

ALDH5|ALDHX|MGC2230;
ALDH1B1;
aldehyde dehydrogenase 1 family, member B1;
ALDH class 2|OTTHUMP00000021399|acetaldehyde dehydrogenase 5|aldehyde dehydrogenase 1B1|aldehyde dehydrogenase 5|mitochondrial aldehyde dehydrogenase X

Description

aldehyde dehydrogenase 1 family, member B1

Xrefs

HGNC:407| MIM:100670| Ensembl:ENSG00000137124| HPRD:00005

Chromosome

9 : 9p11.1

Links to iHOP

219

Sequence Information

Nucleotide sequence

>219 : length: 1554
atgctgcgcttcctggcaccccggctgcttagcctccagggcaggaccgcccgctactcc
tcggcagcagccctcccaagccccattctgaacccagacatcccctacaaccagctgttc
atcaacaatgaatggcaagatgcagtcagcaagaagaccttcccgacggtcaaccctacc
accggggaggtcattgggcacgtggctgaaggtgaccgggctgatgtggatcgggccgtg
aaagcagcccgggaagccttccgcctggggtccccatggcgccggatggatgcctctgag
cggggccggctgctgaaccgcctggcagacctagtggagcgggatcgagtctacttggcc
tcactcgagaccttggacaatgggaagcctttccaagagtcttacgccttggacttggat
gaggtcatcaaggtgtatcggtactttgctggctgggctgacaagtggcatggcaagacc
atccccatggatggccagcatttctgcttcacccggcatgagcccgttggtgtctgtggc
cagatcatcccgtggaacttccccttggtcatgcagggttggaaacttgccccggcactc
gccacaggcaacactgtggttatgaaggtggcagagcagacccccctctctgccctgtat
ttggcctccctcatcaaggaggcaggctttccccctggggtggtgaacatcatcacgggg
tatggcccaacagcaggtgcggccatcgcccagcacgtggatgttgacaaagttgccttc
accggttccaccgaggtgggccacctgatccagaaagcagctggcgattccaacctcaag
agagtcaccctggagctgggtggtaagagccccagcatcgtgctggccgatgctgacatg
gagcatgccgtggagcagtgccacgaagccctgttcttcaacatgggccagtgctgctgt
gctggctcccggaccttcgtggaagaatccatctacaatgagtttctcgagagaaccgtg
gagaaagcaaagcagaggaaagtggggaacccctttgagctggacacccagcaggggcct
caggtggacaaggagcagtttgaacgagtcctaggctacatccagcttggccagaaggag
ggcgcaaaactcctctgtggcggagagcgtttcggggagcgtggtttcttcatcaagcct
actgtctttggtggcgtgcaggatgacatgagaattgccaaagaggagatctttgggcct
gtgcagcccctgttcaagttcaagaagattgaggaggtggttgagagggccaacaacacc
aggtatggcctggctgcggctgtgttcacccgggatctggacaaggccatgtacttcacc
caggcactccaggccgggaccgtgtgggtaaacacctacaacatcgtcacctgccacacg
ccatttggagggtttaaggaatctggaaacgggagggagctgggtgaggatgggcttaag
gcctacacagaggtaaagacggtcaccatcaaggttcctcagaagaactcgtaa

Protein sequence

>219 : length: 517
MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPT
TGEVIGHVAEGDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVYLA
SLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPVGVCG
QIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITG
YGPTAGAAIAQHVDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADM
EHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQGP
QVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGP
VQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHT
PFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS



Basic Information

Gene ID

220, ALDH1A3

Enzyme Number

1.2.1.3

RLRdb entry

RL00062

Organisms

Human (9606)

Synonyms

ALDH1A6|ALDH6|RALDH3;
ALDH1A3;
aldehyde dehydrogenase 1 family, member A3;
acetaldehyde dehydrogenase 6|aldehyde dehydrogenase 1A3|aldehyde dehydrogenase 6|retinaldehyde dehydrogenase 3

Description

aldehyde dehydrogenase 1 family, member A3

Xrefs

HGNC:409| MIM:600463| Ensembl:ENSG00000184254| HPRD:02713

Chromosome

15 : 15q26.3

Links to iHOP

220

Sequence Information

Nucleotide sequence

>220 : length: 1539
atggccaccgctaacggggccgtggaaaacgggcagccggacaggaagccgccggccctg
ccgcgccccatccgcaacctggaggtcaagttcaccaagatatttatcaacaatgaatgg
cacgaatccaagagtgggaaaaagtttgctacatgtaacccttcaactcgggagcaaata
tgtgaagtggaagaaggagataagcccgacgtggacaaggctgtggaggctgcacaggtt
gccttccagaggggctcgccatggcgccggctggatgccctgagtcgtgggcggctgctg
caccagctggctgacctggtggagagggaccgcgccaccttggccgccctggagacgatg
gatacagggaagccatttcttcatgcttttttcatcgacctggagggctgtattagaacc
ctcagatactttgcagggtgggcagacaaaatccagggcaagaccatccccacagatgac
aacgtcgtgtgcttcaccaggcatgagcccattggtgtctgtggggccatcactccatgg
aacttccccctgctgatgctggtgtggaagctggcacccgccctctgctgtgggaacacc
atggtcctgaagcctgcggagcagacacctctcaccgccctttatctcggctctctgatc
aaagaggccgggttccctccaggagtggtgaacattgtgccaggattcgggcccacagtg
ggagcagcaatttcttctcaccctcagatcaacaagatcgccttcaccggctccacagag
gttggaaaactggttaaagaagctgcgtcccggagcaatctgaagcgggtgacgctggag
ctgggggggaagaacccctgcatcgtgtgtgcggacgctgacttggacttggcagtggag
tgtgcccatcagggagtgttcttcaaccaaggccagtgttgcacggcagcctccagggtg
ttcgtggaggagcaggtctactctgagtttgtcaggcggagcgtggagtatgccaagaaa
cggcccgtgggagaccccttcgatgtcaaaacagaacaggggcctcagattgatcaaaag
cagttcgacaaaatcttagagctgatcgagagtgggaagaaggaaggggccaagctggaa
tgcgggggctcagccatggaagacaaggggctcttcatcaaacccactgtcttctcagaa
gtcacagacaacatgcggattgccaaagaggagattttcgggccagtgcaaccaatactg
aagttcaaaagtatcgaagaagtgataaaaagagcgaatagcaccgactatggactcaca
gcagccgtgttcacaaaaaatctcgacaaagccctgaagttggcttctgccttagagtct
ggaacggtctggatcaactgctacaacgccctctatgcacaggctccatttggtggcttt
aaaatgtcaggaaatggcagagaactaggtgaatacgctttggccgaatacacagaagtg
aaaactgtcaccatcaaacttggcgacaagaacccctga

Protein sequence

>220 : length: 512
MATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFATCNPSTREQI
CEVEEGDKPDVDKAVEAAQVAFQRGSPWRRLDALSRGRLLHQLADLVERDRATLAALETM
DTGKPFLHAFFIDLEGCIRTLRYFAGWADKIQGKTIPTDDNVVCFTRHEPIGVCGAITPW
NFPLLMLVWKLAPALCCGNTMVLKPAEQTPLTALYLGSLIKEAGFPPGVVNIVPGFGPTV
GAAISSHPQINKIAFTGSTEVGKLVKEAASRSNLKRVTLELGGKNPCIVCADADLDLAVE
CAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYAKKRPVGDPFDVKTEQGPQIDQK
QFDKILELIESGKKEGAKLECGGSAMEDKGLFIKPTVFSEVTDNMRIAKEEIFGPVQPIL
KFKSIEEVIKRANSTDYGLTAAVFTKNLDKALKLASALESGTVWINCYNALYAQAPFGGF
KMSGNGRELGEYALAEYTEVKTVTIKLGDKNP



Basic Information

Gene ID

223, ALDH9A1

Enzyme Number

1.2.1.3

RLRdb entry

RL00062

Organisms

Human (9606)

Synonyms

ALDH4|ALDH7|ALDH9|E3|TMABADH;
ALDH9A1;
aldehyde dehydrogenase 9 family, member A1;
4-trimethylaminobutyraldehyde dehydrogenase|OTTHUMP00000032604|R-aminobutyraldehyde dehydrogenase|aldehyde dehydrogenase (NAD+)|aldehyde dehydrogenase 9A1|aldehyde dehydrogenase E3 isozyme|gamma-aminobutyraldehyde dehydrogenase

Description

aldehyde dehydrogenase 9 family, member A1

Xrefs

HGNC:412| MIM:602733| Ensembl:ENSG00000143149| HPRD:04109

Chromosome

1 : 1q23.1

Links to iHOP

223

Sequence Information

Nucleotide sequence

>223 : length: 1557
atgtttctccgagcaggcctggccgcgctctccccgcttcttcgcagtcttcggccctct
cctgtcgccgccatgagcactggcaccttcgtcgtgtcgcagccgctcaattaccgcggc
ggggcccgcgtggagccggcggacgcctccggtaccgagaaagctttcgagccagcaacc
ggccgagtgatagctactttcacatgttcaggagaaaaggaagtaaatttggctgttcaa
aatgcaaaggctgcttttaaaatatggagtcaaaaatctggcatggagcgttgccgaatc
cttttggaggctgccaggataataagggaacgggaggatgaaattgctactatggagtgc
atcaacaatggcaagtccatctttgaggcccgcttggacattgacatttcctggcagtgc
ctggagtattatgcgggcttggctgcatccatggctggtgaacacatccagctcccaggt
ggatcgtttggttataccagaagagaaccacttggggtatgtgtgggaataggagcatgg
aactacccctttcagattgcctcttggaagtcggctccagcattagcctgtggtaatgcc
atggtctttaaaccttctccctttacacctgtttctgcattgctactggctgaaatctac
agtgaggctggtgtacctcctgggctcttcaatgtggtgcagggaggggctgccacaggc
cagtttctgtgtcagcatcccgatgtggccaaagtctccttcactggaagtgtgcccact
ggcatgaagatcatggagatgtcagctaaaggaatcaaacctgttaccttggaacttgga
ggcaaatctccactcatcatcttctcagactgtgatatgaacaatgctgtaaagggggcg
ctgatggccaacttcctcacacaaggccaggtttgctgtaatggcacaagagtatttgtg
cagaaagaaattcttgataaatttacagaggaagtggtgaaacagacccaaaggattaaa
attggagatccccttctggaagatacaaggatgggtccactcatcaaccgaccacacctg
gagcgagtccttgggtttgtcaaagtggcaaaggagcagggtgctaaagtgttatgtggt
ggagatatatatgtacctgaagatcccaaattaaaggatggatattacatgagaccttgt
gtattaactaattgcagagacgacatgacctgtgtgaaggaagagatctttgggcctgtt
atgtccattttatcatttgacactgaagctgaggttctagaaagagccaatgataccact
tttggactagcagctggcgtctttaccagggacatccaacgggctcatagagtggtagct
gagcttcaggctgggacgtgcttcattaacaactataacgtcagcccagtggagttgccc
tttggtggatataagaagtcaggatttggcagagagaacggccgtgtgacaatcgaatat
tattcacagctgaagactgtgtgtgtggagatgggtgatgtggaatctgctttttga

Protein sequence

>223 : length: 518
MFLRAGLAALSPLLRSLRPSPVAAMSTGTFVVSQPLNYRGGARVEPADASGTEKAFEPAT
GRVIATFTCSGEKEVNLAVQNAKAAFKIWSQKSGMERCRILLEAARIIREREDEIATMEC
INNGKSIFEARLDIDISWQCLEYYAGLAASMAGEHIQLPGGSFGYTRREPLGVCVGIGAW
NYPFQIASWKSAPALACGNAMVFKPSPFTPVSALLLAEIYSEAGVPPGLFNVVQGGAATG
QFLCQHPDVAKVSFTGSVPTGMKIMEMSAKGIKPVTLELGGKSPLIIFSDCDMNNAVKGA
LMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHL
ERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPV
MSILSFDTEAEVLERANDTTFGLAAGVFTRDIQRAHRVVAELQAGTCFINNYNVSPVELP
FGGYKKSGFGRENGRVTIEYYSQLKTVCVEMGDVESAF



Basic Information

Gene ID

224, ALDH3A2

Enzyme Number

1.2.1.3

RLRdb entry

RL00062

Organisms

Human (9606)

Synonyms

ALDH10|DKFZp686E23276|FALDH|FLJ20851|SLS;
ALDH3A2;
aldehyde dehydrogenase 3 family, member A2;
OTTHUMP00000065801|aldehyde dehydrogenase 10|aldehyde dehydrogenase 3A2|fatty aldehyde dehydrogenase

Description

aldehyde dehydrogenase 3 family, member A2

Xrefs

HGNC:403| MIM:609523| Ensembl:ENSG00000072210| HPRD:07188

Chromosome

17 : 17p11.2

Links to iHOP

224

Sequence Information

Nucleotide sequence

>224 : length: 1458
atggagctcgaagtccggcgggtccgacaggcgttcctgtccggccggtcgcgacctctg
cggtttcggctgcagcagctggaggccctgcggaggatggtgcaggagcgcgagaaggat
atcctgacggccatcgccgccgacctgtgcaagagtgaattcaatgtgtacagtcaggaa
gtcattactgtccttggggaaattgattttatgcttgagaatcttcctgaatgggttact
gctaaaccagttaagaagaacgtgctcaccatgctggatgaggcctatattcagccacag
cctctgggagtggtgctgataatcggagcttggaattaccccttcgttctcaccattcag
ccactgataggagccatcgctgcaggaaatgctgtgattataaagccttctgaactgagt
gaaaatacagccaagatcttggcaaagcttctccctcagtatttagaccaggatctctat
attgttattaatggtggtgttgaggaaaccacggagctcctgaagcagcgatttgaccac
attttctatacgggaaacactgcggttggcaaaattgtcatggaagctgctgccaagcat
ctgacccctgtgactcttgaactgggagggaaaagtccatgttatattgataaagattgt
gacctggacattgtttgcagacgcataacctggggaaaatacatgaattgtggccaaacc
tgcattgcacccgactatattctctgtgaagcatccctccaaaatcaaattgtatggaag
attaaggaaacagtgaaggaattttatggagaaaatataaaagagtctcctgattatgaa
aggatcatcaatcttcgtcattttaagaggatactaagtttgcttgaaggacaaaagata
gcttttggtggggagactgatgaggccacacgctacatagccccaacagtacttaccgat
gttgatcctaaaaccaaggtgatgcaagaagaaatttttggaccaattcttccaatagtg
cctgtgaaaaatgtagatgaggccataaatttcataaatgaacgtgaaaagcctctggct
ctttatgtattttcgcataaccataagctcatcaaacggatgattgatgagacatccagt
ggaggtgtcacaggcaatgacgtcattatgcacttcacgctcaactctttcccatttgga
ggagtgggttccagtgggatgggagcttatcacggaaaacatagttttgatactttttct
catcagcgtccctgtttattaaaaagtttaaagagagaaggtgctaacaaactcagatat
cctcccaacagccagtcaaaggtggattggggaaaattttttctcttgaaacggttcaac
aaagaaaaactcggtctcctgttgctcactttcctgggtattgtagccgctgtgcttgtc
aaggcagaatattactga

Protein sequence

>224 : length: 485
MELEVRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQE
VITVLGEIDFMLENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQ
PLIGAIAAGNAVIIKPSELSENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDH
IFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQT
CIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQKI
AFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAINFINEREKPLA
LYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFS
HQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKEKLGLLLLTFLGIVAAVLV
KAEYY



Basic Information

Gene ID

501, ALDH7A1

Enzyme Number

1.2.1.3

RLRdb entry

RL00062

Organisms

Human (9606)

Synonyms

ATQ1|EPD|FLJ11738|FLJ92814|PDE;
ALDH7A1;
aldehyde dehydrogenase 7 family, member A1;
26g turgor protein homolog|P6c dehydrogenase|alpha-AASA dehydrogenase|alpha-aminoadipic semialdehyde dehydrogenase|antiquitin 1|delta1-piperideine-6-carboxylate dehydrogenease

Description

aldehyde dehydrogenase 7 family, member A1

Xrefs

HGNC:877| MIM:107323| Ensembl:ENSG00000164904| HPRD:00124

Chromosome

5 : 5q31

Links to iHOP

501

Sequence Information

Nucleotide sequence

>501 : length: 1620
atgtggcgccttcctcgcgcgctgtgtgtgcacgctgcaaagaccagcaagctctctgga
ccttggagcaggcctgccgccttcatgtccactctcctcatcaatcagccccagtatgcg
tggctgaaagagctggggctccgcgaggaaaacgagggcgtgtataatggaagctgggga
ggccggggagaggttattacgacctattgccctgctaacaacgagccaatagcaagagtc
cgacaggccagtgtggcagactatgaagaaactgtaaagaaagcaagagaagcatggaaa
atctgggcagatattcctgctccaaaacgaggagaaatagtaagacagattggcgatgcc
ttgcgggagaagatccaagtactaggaagcttggtgtctttggagatggggaaaatctta
gtggaaggtgtgggtgaagttcaggagtatgtggatatctgtgactatgctgttggttta
tcaaggatgattggaggacctatcttgccttctgaaagatctggccatgcactgattgag
cagtggaatcccgtaggcctggttggaatcatcacggcattcaatttccctgtggcagtg
tatggttggaacaacgccatcgccatgatctgtggaaatgtctgcctctggaaaggagct
ccaaccacttccctcattagtgtggctgtcacaaagataatagccaaggttctggaggac
aacaagctgcctggtgcaatttgttccttgacttgtggtggagcagatattggcacagca
atggccaaagatgaacgagtgaacctgctgtccttcactgggagcactcaggtgggaaaa
caggtgggcctgatggtgcaggagaggtttgggagaagtctgttggaacttggaggaaac
aatgccattattgcctttgaagatgcagacctcagcttagttgttccatcagctctcttc
gctgctgtgggaacagctggccagaggtgtaccactgcgaggcgactgtttatacatgaa
agcatccatgatgaggttgtaaacagacttaaaaaggcctatgcacagatccgagttggg
aacccatgggaccctaatgttctctatgggccactccacaccaagcaggcagtgagcatg
tttcttggagcagtggaagaagcaaagaaagaaggtggcacagtggtctatgggggcaag
gttatggatcgccctggaaattatgtagaaccgacaattgtgacaggtcttggccacgat
gcgtccattgcacacacagagacttttgctccgattctctatgtctttaaattcaagaat
gaagaagaggtctttgcatggaataatgaagtaaaacagggactttcaagtagcatcttt
accaaagatctgggcagaatctttcgctggcttggacctaaaggatcagactgtggcatt
gtaaatgtcaacattccaacaagtggggctgagattggaggtgcctttggaggagaaaag
cacactggtggtggcagggagtctggcagtgatgcctggaaacagtacatgagaaggtct
acttgtactatcaactacagtaaagaccttcctctggcccaaggaatcaagtttcagtaa

Protein sequence

>501 : length: 539
MWRLPRALCVHAAKTSKLSGPWSRPAAFMSTLLINQPQYAWLKELGLREENEGVYNGSWG
GRGEVITTYCPANNEPIARVRQASVADYEETVKKAREAWKIWADIPAPKRGEIVRQIGDA
LREKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERSGHALIE
QWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIAKVLED
NKLPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGKQVGLMVQERFGRSLLELGGN
NAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVG
NPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHD
ASIAHTETFAPILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGI
VNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min