Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

218, ALDH3A1

Enzyme Number

1.2.1.3

RLRdb entry

RL00062

Organisms

Human (9606)

Synonyms

ALDH3|ALDHIII|MGC10406;
ALDH3A1;
aldehyde dehydrogenase 3 family, memberA1;
aldehyde dehydrogenase 3A1|aldehyde dehydrogenase isozyme 3|aldehyde dehydrogenase type III|aldehyde dehydrogenase, dimeric NADP-preferring|stomach aldehyde dehydrogenase

Description

aldehyde dehydrogenase 3 family, memberA1

Xrefs

HGNC:405| MIM:100660| Ensembl:ENSG00000108602| HPRD:00004

Chromosome

17 : 17p11.2

Links to iHOP

218

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

218 218 PMID: 12081471
218 218 PMID: 16189514

Sequence Information

Nucleotide sequence

>218 : length: 1362
atgagcaagatcagcgaggccgtgaagcgcgcccgcgccgccttcagctcgggcaggacc
cgtccgctgcagttccggatccagcagctggaggcgctgcagcgcctgatccaggagcag
gagcaggagctggtgggcgcgctggccgcagacctgcacaagaatgaatggaacgcctac
tatgaggaggtggtgtacgtcctagaggagatcgagtacatgatccagaagctccctgag
tgggccgcggatgagcccgtggagaagacgccccagactcagcaggacgagctctacatc
cactcggagccactgggcgtggtcctcgtcattggcacctggaactaccccttcaacctc
accatccagcccatggtgggcgccatcgctgcagggaactcagtggtcctcaagccctcg
gagctgagtgagaacatggcgagcctgctggctaccatcatcccccagtacctggacaag
gatctgtacccagtaatcaatgggggtgtccctgagaccacggagctgctcaaggagagg
ttcgaccatatcctgtacacgggcagcacgggggtggggaagatcatcatgacggctgct
gccaagcacctgacccctgtcacgctggagctgggagggaagagtccctgctacgtggac
aagaactgtgacctggacgtggcctgccgacgcatcgcctgggggaaattcatgaacagt
ggccagacctgcgtggcccctgactacatcctctgtgacccctcgatccagaaccaaatt
gtggagaagctcaagaagtcactgaaagagttctacggggaagatgctaagaaatcccgg
gactatggaagaatcattagtgcccggcacttccagagggtgatgggcctgattgagggc
cagaaggtggcttatgggggcaccggggatgccgccactcgctacatagcccccaccatc
ctcacggacgtggacccccagtccccggtgatgcaagaggagatcttcgggcctgtgctg
cccatcgtgtgcgtgcgcagcctggaggaggccatccagttcatcaaccagcgtgagaag
cccctggccctctacatgttctccagcaacgacaaggtgattaagaagatgattgcagag
acatccagtggtggggtggcggccaacgatgtcatcgtccacatcaccttgcactctctg
cccttcgggggcgtggggaacagcggcatgggatcctaccatggcaagaagagcttcgag
actttctctcaccgccgctcttgcctggtgaggcctctgatgaatgatgaaggcctgaag
gtcagataccccccgagcccggccaagatgacccagcactga

Protein sequence

>218 : length: 453
MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALQRLIQEQEQELVGALAADLHKNEWNAY
YEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNL
TIQPMVGAIAAGNSVVLKPSELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKER
FDHILYTGSTGVGKIIMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKFMNS
GQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRIISARHFQRVMGLIEG
QKVAYGGTGDAATRYIAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEEAIQFINQREK
PLALYMFSSNDKVIKKMIAETSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFE
TFSHRRSCLVRPLMNDEGLKVRYPPSPAKMTQH



Basic Information

Gene ID

220, ALDH1A3

Enzyme Number

1.2.1.3

RLRdb entry

RL00062

Organisms

Human (9606)

Synonyms

ALDH1A6|ALDH6|RALDH3;
ALDH1A3;
aldehyde dehydrogenase 1 family, member A3;
acetaldehyde dehydrogenase 6|aldehyde dehydrogenase 1A3|aldehyde dehydrogenase 6|retinaldehyde dehydrogenase 3

Description

aldehyde dehydrogenase 1 family, member A3

Xrefs

HGNC:409| MIM:600463| Ensembl:ENSG00000184254| HPRD:02713

Chromosome

15 : 15q26.3

Links to iHOP

220

Sequence Information

Nucleotide sequence

>220 : length: 1539
atggccaccgctaacggggccgtggaaaacgggcagccggacaggaagccgccggccctg
ccgcgccccatccgcaacctggaggtcaagttcaccaagatatttatcaacaatgaatgg
cacgaatccaagagtgggaaaaagtttgctacatgtaacccttcaactcgggagcaaata
tgtgaagtggaagaaggagataagcccgacgtggacaaggctgtggaggctgcacaggtt
gccttccagaggggctcgccatggcgccggctggatgccctgagtcgtgggcggctgctg
caccagctggctgacctggtggagagggaccgcgccaccttggccgccctggagacgatg
gatacagggaagccatttcttcatgcttttttcatcgacctggagggctgtattagaacc
ctcagatactttgcagggtgggcagacaaaatccagggcaagaccatccccacagatgac
aacgtcgtgtgcttcaccaggcatgagcccattggtgtctgtggggccatcactccatgg
aacttccccctgctgatgctggtgtggaagctggcacccgccctctgctgtgggaacacc
atggtcctgaagcctgcggagcagacacctctcaccgccctttatctcggctctctgatc
aaagaggccgggttccctccaggagtggtgaacattgtgccaggattcgggcccacagtg
ggagcagcaatttcttctcaccctcagatcaacaagatcgccttcaccggctccacagag
gttggaaaactggttaaagaagctgcgtcccggagcaatctgaagcgggtgacgctggag
ctgggggggaagaacccctgcatcgtgtgtgcggacgctgacttggacttggcagtggag
tgtgcccatcagggagtgttcttcaaccaaggccagtgttgcacggcagcctccagggtg
ttcgtggaggagcaggtctactctgagtttgtcaggcggagcgtggagtatgccaagaaa
cggcccgtgggagaccccttcgatgtcaaaacagaacaggggcctcagattgatcaaaag
cagttcgacaaaatcttagagctgatcgagagtgggaagaaggaaggggccaagctggaa
tgcgggggctcagccatggaagacaaggggctcttcatcaaacccactgtcttctcagaa
gtcacagacaacatgcggattgccaaagaggagattttcgggccagtgcaaccaatactg
aagttcaaaagtatcgaagaagtgataaaaagagcgaatagcaccgactatggactcaca
gcagccgtgttcacaaaaaatctcgacaaagccctgaagttggcttctgccttagagtct
ggaacggtctggatcaactgctacaacgccctctatgcacaggctccatttggtggcttt
aaaatgtcaggaaatggcagagaactaggtgaatacgctttggccgaatacacagaagtg
aaaactgtcaccatcaaacttggcgacaagaacccctga

Protein sequence

>220 : length: 512
MATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFATCNPSTREQI
CEVEEGDKPDVDKAVEAAQVAFQRGSPWRRLDALSRGRLLHQLADLVERDRATLAALETM
DTGKPFLHAFFIDLEGCIRTLRYFAGWADKIQGKTIPTDDNVVCFTRHEPIGVCGAITPW
NFPLLMLVWKLAPALCCGNTMVLKPAEQTPLTALYLGSLIKEAGFPPGVVNIVPGFGPTV
GAAISSHPQINKIAFTGSTEVGKLVKEAASRSNLKRVTLELGGKNPCIVCADADLDLAVE
CAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYAKKRPVGDPFDVKTEQGPQIDQK
QFDKILELIESGKKEGAKLECGGSAMEDKGLFIKPTVFSEVTDNMRIAKEEIFGPVQPIL
KFKSIEEVIKRANSTDYGLTAAVFTKNLDKALKLASALESGTVWINCYNALYAQAPFGGF
KMSGNGRELGEYALAEYTEVKTVTIKLGDKNP



Basic Information

Gene ID

,

Enzyme Number

Organisms

()

Synonyms

;
;
;
;

Description

Xrefs

Chromosome

:

Links to iHOP

Sequence Information

Nucleotide sequence

>221 : length: 

Protein sequence

>221 : length: 



Basic Information

Gene ID

,

Enzyme Number

Organisms

()

Synonyms

;
;
;
;

Description

Xrefs

Chromosome

:

Links to iHOP

Sequence Information

Nucleotide sequence

>222 : length: 

Protein sequence

>222 : length: 



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min