Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

231, AKR1B1

Enzyme Number

1.1.1.21

RLRdb entry

RL00250

Organisms

Human (9606)

Synonyms

ADR|ALDR1|ALR2|AR|MGC1804;
AKR1B1;
aldo-keto reductase family 1, member B1 (aldose reductase);
Lii5-2 CTCL tumor antigen|aldehyde reductase 1|aldo-keto reductase family 1, member B1|aldose reductase|low Km aldose reductase

Description

aldo-keto reductase family 1, member B1 (aldose reductase)

Xrefs

HGNC:381| MIM:103880| Ensembl:ENSG00000085662| HPRD:00071

Chromosome

7 : 7q35

Links to iHOP

231

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

231 4086 PMID: 16189514
231 7030 PMID: 17353931

Sequence Information

Nucleotide sequence

>231 : length: 951
atggcaagccgtctcctgctcaacaacggcgccaagatgcccatcctggggttgggtacc
tggaagtcccctccagggcaggtgactgaggccgtgaaggtggccattgacgtcgggtac
cgccacatcgactgtgcccatgtgtaccagaatgagaatgaggtgggggtggccattcag
gagaagctcagggagcaggtggtgaagcgtgaggagctcttcatcgtcagcaagctgtgg
tgcacgtaccatgagaagggcctggtgaaaggagcctgccagaagacactcagcgacctg
aagctggactacctggacctctaccttattcactggccgactggctttaagcctgggaag
gaatttttcccattggatgagtcgggcaatgtggttcccagtgacaccaacattctggac
acgtgggcggccatggaagagctggtggatgaagggctggtgaaagctattggcatctcc
aacttcaaccatctccaggtggagatgatcttaaacaaacctggcttgaagtataagcct
gcagttaaccagattgagtgccacccatatctcactcaggagaagttaatccagtactgc
cagtccaaaggcatcgtggtgaccgcctacagccccctcggctctcctgacaggccctgg
gccaagcccgaggacccttctctcctggaggatcccaggatcaaggcgatcgcagccaag
cacaataaaactacagcccaggtcctgatccggttccccatgcagaggaacttggtggtg
atccccaagtctgtgacaccagaacgcattgctgagaactttaaggtctttgactttgaa
ctgagcagccaggatatgaccaccttactcagctacaacaggaactggagggtctgtgcc
ttgttgagctgtacctcccacaaggattaccccttccatgaagagttttga

Protein sequence

>231 : length: 316
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK
EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min