Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

23396, PIP5K1C

Enzyme Number

2.7.1.68

RLRdb entry

RL00070

Organisms

Human (9606)

Synonyms

KIAA0589|LCCS3|PIP5K-GAMMA|PIP5Kgamma;
PIP5K1C;
phosphatidylinositol-4-phosphate 5-kinase, type I, gamma;
Human homolog of mouse phosphatidylinositol-4-phosphate 5-kinase I-gamma|PtdIns(4)P-5-kinase|diphosphoinositide kinase|phosphatidylinositol-4-phosphate 5-kinase I-gamma|type I PIP kinase

Description

phosphatidylinositol-4-phosphate 5-kinase, type I, gamma

Xrefs

HGNC:8996| MIM:606102| Ensembl:ENSG00000186111| HPRD:05834

Chromosome

19 : 19p13.3

Links to iHOP

23396

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

23396 138429 PMID: 14701839
23396 83660 PMID: 12422219
23396 382 PMID: 12847086

Sequence Information

Nucleotide sequence

>23396 : length: 2007
atggagctggaggtaccggacgaggcggagagcgctgaggcgggggccgtgccctcggag
gcggcgtgggcggcagagagcggggcggcggcaggtttggctcagaagaaggcggcccca
acagaggttctgtccatgacggcacagccgggccctggccatgggaagaagttgggccat
cgaggtgtggacgcatccggcgaaaccacctacaagaagaccacctcctccaccctgaag
ggtgccatccagctgggcatcggctacaccgtgggccacctgagctccaagcccgaacgc
gacgtgctcatgcaggacttctacgtggtggagagcatcttcttccccagcgaaggcagc
aacctcacccccgcccaccacttccaggacttccgcttcaagacctatgcacctgtcgcc
ttccgctacttccgggagctctttgggatccggccagatgattacttgtactccctgtgc
aatgagccgctgatcgagctgtccaacccgggcgccagtggctccctcttctacgtcacc
agcgacgacgagttcatcatcaagaccgtcatgcacaaggaggccgagttcctgcagaag
ctgctccctggctactacatgaacctcaaccagaacccgcggacgctgctgcccaagttc
tatgggctgtactgcgtgcagtcggggggcaagaacatccgcgtcgtggtcatgaacaac
atcctgccccgcgtggtcaagatgcacctcaagttcgacctcaagggctccacctacaag
cggcgcgccagcaagaaggagaaggagaagagcttccccacctacaaggacctggacttc
atgcaggacatgcccgaggggctcctgctggacgccgacaccttcagcgccctggtcaag
acgctgcagcgggactgcctggtcctggaaagtttcaagatcatggactacagcctgctg
ctgggcgtgcacaacatcgaccagcacgagcgcgagcggcaggcgcagggcgcccagagc
acctcagatgagaagcggcctgtgggccagaaggcgctctactccacggccatggagtcc
atccagggtggcgccgcgcgcggggaggccatcgaatcggatgacacgatgggcgggatc
cccgctgtgaacggccgcggggagcggctgctgctgcacattggcatcatcgacatcctg
cagtcctacaggttcatcaagaaactggagcacacctggaaggccctcgtccacgatggg
gacacggtgtccgtccaccgccccagcttctatgccgagcgctttttcaagttcatgagc
aacacggtctttcggaagaactcctccctgaagtcctcgccctccaagaaggggcgcggc
ggagccttgctagctgtgaaaccgctggggcccaccgctgccttctcggccagccagatc
cctagcgagcgggaggaggcccagtacgacctgcggggggcccgcagctaccccacgctg
gaggacgaaggccggcccgacctcctgccctgcacgccaccttctttcgaagaagccact
acagcctccattgccacgactctgtcatccacatccctctccattcctgagcggtccccc
tcggagacgtcggagcagccgcggtacaggcggcgcacacagtcgtctggacaggatggc
aggccgcaggaggagccacccgcggaagaggatctgcagcagattacagtgcaggtggag
cctgcgtgcagcgtggagattgtggtccccaaagaggaggacgcaggggtggaggcttcc
ccggccggtgcctctgctgctgttgaagtagaaactgccagccaggcctcagacgaggag
ggcgcacctgccagccaggcctcggacgaggaggacgcgcccgccaccgacatctacttt
cccaccgatgagaggagctgggtgtactccccgctccactatagcgcccaggcccccccg
gcctccgacggcgagagcgacacataa

Protein sequence

>23396 : length: 668
MELEVPDEAESAEAGAVPSEAAWAAESGAAAGLAQKKAAPTEVLSMTAQPGPGHGKKLGH
RGVDASGETTYKKTTSSTLKGAIQLGIGYTVGHLSSKPERDVLMQDFYVVESIFFPSEGS
NLTPAHHFQDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSLFYVT
SDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQSGGKNIRVVVMNN
ILPRVVKMHLKFDLKGSTYKRRASKKEKEKSFPTYKDLDFMQDMPEGLLLDADTFSALVK
TLQRDCLVLESFKIMDYSLLLGVHNIDQHERERQAQGAQSTSDEKRPVGQKALYSTAMES
IQGGAARGEAIESDDTMGGIPAVNGRGERLLLHIGIIDILQSYRFIKKLEHTWKALVHDG
DTVSVHRPSFYAERFFKFMSNTVFRKNSSLKSSPSKKGRGGALLAVKPLGPTAAFSASQI
PSEREEAQYDLRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSP
SETSEQPRYRRRTQSSGQDGRPQEEPPAEEDLQQITVQVEPACSVEIVVPKEEDAGVEAS
PAGASAAVEVETASQASDEEGAPASQASDEEDAPATDIYFPTDERSWVYSPLHYSAQAPP
ASDGESDT



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min