Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

234724, Tat

Enzyme Number

2.6.1.5

RLRdb entry

RL00368

Organisms

Mouse (10090)

Synonyms

MGC37772|MGC37789|MGC37790|MGC37819|MGC37828|MGC37842;
Tat;
tyrosine aminotransferase;
-

Description

tyrosine aminotransferase

Xrefs

MGI:98487| Ensembl:ENSMUSG00000001670

Chromosome

8 : 8 D3

Links to iHOP

234724

Sequence Information

Nucleotide sequence

>234724 : length: 1365
atggactcctacgtaatccagacgaatgtcaatgacagcctaccttcagtgctggatgtt
cgcgtcaatattggcgggagaagctcggtgcaagggagagcgaagggcaggaaggccagg
tggaatgtgaggccctctgacatgtccaataaaaccttcaatcccatccgagccattgtg
gacaacatgaaggtgaagccgaatccgaacaaaaccgtgatctctctgtcaattggggac
cctactgtgtttgggaacctgcccacagaccctgaagtgacccaagccatgaaggatgcc
ctggactccgggaagtacaatggctatgccccatctatcggctacctatccagtcgggag
gaggtcgcttcctattaccactgtcctgaggctcctctggaagctaaggatgtcattctg
acgagtggctgcagtcaggccattgagctgtgtctagccgtgttggccaatcctggacag
aacatcctcattccgaggcccgggttttccctctacaggacattggctgagtctatgggg
attgaggtcaagctctacaatctattgcctgagaagtcttgggaaattgatctaaaacaa
ctggaatctctgatcgacgaaaaaacagcttgtctcgtggtcaacaacccgtccaatccc
tgtggctctgtgttcagtaagcggcaccttcagaagattttggcagtggctgaaaggcaa
tgcgtccccatcttagccgatgagatctatggtgacatggtgttttcagattgcaaatat
gaaccaatggccaccctcagcaccaatgtccccatcctgtcctgtggtgggctggccaag
cgctggctggttcctggctggaggctgggctggatccttatccatgatcgaagagacatt
tttggcaatgagattcgggacgggctggtgaagctgagtcagcggatcctgggcccgtgc
accatcgtccaaggtgccctgaagagcatccttcagcgcacccctcaggagttctaccag
gacactttaagcttccttaagtccaatgcggacctctgctatggggcgttgtctgccatt
cctggactccagccagtccgcccatctggagccatgtaccttatggtgggaattgagatg
gagcacttcccagaatttgagaatgacgtggaattcacagagcggttaattgcggagcag
tctgtccactgcctcccagccacgtgcttcgagtacccaaatttcttccgggttgtcatc
acagtccccgaggtgatgatgctggaggcttgtagccggatccaggagttctgtgaacag
cactaccactgtgctgaaggcagccaggaggagtgtgacaaatag

Protein sequence

>234724 : length: 454
MDSYVIQTNVNDSLPSVLDVRVNIGGRSSVQGRAKGRKARWNVRPSDMSNKTFNPIRAIV
DNMKVKPNPNKTVISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGYLSSRE
EVASYYHCPEAPLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMG
IEVKLYNLLPEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQ
CVPILADEIYGDMVFSDCKYEPMATLSTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDI
FGNEIRDGLVKLSQRILGPCTIVQGALKSILQRTPQEFYQDTLSFLKSNADLCYGALSAI
PGLQPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLIAEQSVHCLPATCFEYPNFFRVVI
TVPEVMMLEACSRIQEFCEQHYHCAEGSQEECDK



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min