Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

24616, Pah

Enzyme Number

1.14.16.1

RLRdb entry

RL00401

Organisms

Rat (10116)

Synonyms

Pah;
phenylalanine hydroxylase;
-

Description

phenylalanine hydroxylase

Xrefs

RGD:3248| RATMAP:34254| Ensembl:ENSRNOG00000004302

Chromosome

7 : 7q13

Links to iHOP

24616

Sequence Information

Nucleotide sequence

>24616 : length: 1362
atggcagctgttgtcctggagaatggagtcctgagcagaaaactctcagactttgggcag
gaaacaagctatattgaagacaactccaatcaaaatggtgccatatctctgatattctca
ctcaaagaggaagttggtgccctagccaaggtcctgcgcttatttgaggagaacgatatc
aacctgacacacattgaatccagaccttctcgtttaaacaaagatgagtatgagttcttc
acttatctggataagcgtagcaaacctgttctgggcagcatcatcaagagcctgaggaat
gacattggtgccactgtccacgagctttcccgagacaaggaaaagaacacagtgccctgg
ttcccaaggaccattcaggagttggaccgattcgccaatcagattctcagctatggagcc
gaactggatgcggaccacccaggctttaaagatcctgtgtaccgggcgagacgaaagcag
tttgctgacattgcctacaactaccgccatggccagcccatccctcgggtggaatacaca
gaggaagagaagcagacctggggaacggtgttcaggaccttgaaggccttgtataaaaca
catgcctgctacgagcacaaccacattttcccacttctggaaaagtactgcggtttccgt
gaagacaacattccacagctggaagatgtttctcaatttctgcagacttgtactggtttc
cgcctccgacctgttgctggcttactgtcatctcgagatttcttgggtggcctggccttc
cgagtcttccactgcacacagtacattaggcatggatcgaagcccatgtacacacctgaa
cctgacatctgccatgaactcttgggacatgtgcctttgttttcagatcgcagctttgcc
cagttttctcaggaaattgggcttgcatcactgggggcacctgatgagtacattgagaaa
ctggccacaatttactggtttactgtggagtttgggctttgcaaggaaggagattctata
aaggcatatggtgctgggctcttgtcatcctttggagaattacagtactgtttatcagac
aagccaaagctcctccccctggagctagagaagatagcctgccaggagtattctgtcaca
gagttccagcccttgtactacgtggcggagagtttcagtgatgccaaggagaaagtgagg
acttttgctgccacgatccctcggcccttctcggttcgctatgacccttacactcaaagg
gttgaggtcctggacaatactcagcagttgaagattttagctgactccattaatagtgag
gtcggaatcctttgcaatgccctgcagaagataaagtcgtga

Protein sequence

>24616 : length: 453
MAAVVLENGVLSRKLSDFGQETSYIEDNSNQNGAISLIFSLKEEVGALAKVLRLFEENDI
NLTHIESRPSRLNKDEYEFFTYLDKRSKPVLGSIIKSLRNDIGATVHELSRDKEKNTVPW
FPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYT
EEEKQTWGTVFRTLKALYKTHACYEHNHIFPLLEKYCGFREDNIPQLEDVSQFLQTCTGF
RLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFA
QFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKEGDSIKAYGAGLLSSFGELQYCLSD
KPKLLPLELEKIACQEYSVTEFQPLYYVAESFSDAKEKVRTFAATIPRPFSVRYDPYTQR
VEVLDNTQQLKILADSINSEVGILCNALQKIKS



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min