Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

24693, Ptgs1

Enzyme Number

1.14.99.1

RLRdb entry

RL00448

Organisms

Rat (10116)

Synonyms

Cox-3|Cox1|Cox3;
Ptgs1;
prostaglandin-endoperoxide synthase 1;
cyclooxygenase 1|cyclooxygenase 3|prostaglandin G/H synthase and cyclooxygenase

Description

prostaglandin-endoperoxide synthase 1

Xrefs

RGD:3439| RATMAP:34338| Ensembl:ENSRNOG00000007415

Chromosome

3 : 3p11

Links to iHOP

24693

Sequence Information

Nucleotide sequence

>24693 : length: 1809
atgagtcgaaggagtctctcgctccagtttcccctgctgctgctcctgctgctgctccca
ccacccccggtactgctcacagatgctggggtaccctcaccagtcattccctgttgttac
tatccatgccagaaccagggtgtctgtgtccgcttcggcctcgaccactaccaatgtgac
tgtactcgcacgggctactcgggccccaactgtactatccctgagatctggacctggctt
cggagttccctgcggcccagcccctcattcacccatttcctgctgacacacggatactgg
atctgggagtttgtgaatgccaccttcatccgagaagtactcatgggctgggtactcacg
gtgcggtccaaccttatccccagccctccaacctacaacacagcacatgactatatcagc
tgggagtccttctccaacgtgagctactatactcgcattctgccctctgtacccaaagac
tgtcccacacccatgggaaccaaagggaagaagcagttaccagatattcatcttctggcc
caacgattgctgctgagaagggagttcattcccgccccgcaggggaccaacgtcttgttt
gctttctttgcacaacacttcacccaccagttcttcaagacctctggaaagatgggtcct
ggctttaccaaggccttaggccatggggtagaccttggccacatttatggagatagtctg
gaacgacagtaccacctgcggctcttcaaggatgggaaacttaagtaccaggtgctggat
ggagagttgtacccaccttccgtagaacaggcgtccgtgaagatgcgctacccaccaggt
gtcccgcccgaaaagcagatggctgtggcccaggaggtgtttgggttgctcccgggtctg
atgctcttctccacgatctggctgcgcgagcataaccgtgtgtgtgacttgctgaaggag
gagcatcctacatgggatgacgagcagctcttccagaccactcgcctcatccttagaggg
gaaaccatcgagattatcatcgaggagtacgtacagcacttgagtggctatttcctccag
ctcaagtttgacccggagctcctgttccgagcccagttccagtatcgcaaccgcatcgcc
atggaattcaaccacctctatcactggcatccgttcatgcctgattccttccaagtgggc
tcacaagagtacagctatgagcagtttttatttaacacatctatgctggtggactacggt
gtcgaggcactggtggatgccttctctcgccagagggctggccggattggtgggggtagg
aactttgactaccatgttctgcatgtggccgaggatgtcatcaaggagtcccgagaaatg
cgcctgcagtccttcaatgaataccgaaagaggtttggcctgaagccttacacttctttc
caggagttcacaggagagaaggagatggccgctgagttggaggagctatatggtgacatc
gatgctttagagttctacccggggctgatgctggagaagtgccagcccaactccctcttt
ggggagagcatgatagagatgggggctcctttctccctcaagggcctcctagggaatccc
atctgttccccagagtactggaaacccagcacattcggtggtgatgtgggtttcaacatc
gttaacacagcctcactgaagaaactggtctgcctcaacaccaagacctgcccctatgtc
tccttccgtgtgccagattaccctggagatgacgggtctgtcttcgtgagaccgtccact
gagctctga

Protein sequence

>24693 : length: 602
MSRRSLSLQFPLLLLLLLLPPPPVLLTDAGVPSPVIPCCYYPCQNQGVCVRFGLDHYQCD
CTRTGYSGPNCTIPEIWTWLRSSLRPSPSFTHFLLTHGYWIWEFVNATFIREVLMGWVLT
VRSNLIPSPPTYNTAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDIHLLA
QRLLLRREFIPAPQGTNVLFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDSL
ERQYHLRLFKDGKLKYQVLDGELYPPSVEQASVKMRYPPGVPPEKQMAVAQEVFGLLPGL
MLFSTIWLREHNRVCDLLKEEHPTWDDEQLFQTTRLILRGETIEIIIEEYVQHLSGYFLQ
LKFDPELLFRAQFQYRNRIAMEFNHLYHWHPFMPDSFQVGSQEYSYEQFLFNTSMLVDYG
VEALVDAFSRQRAGRIGGGRNFDYHVLHVAEDVIKESREMRLQSFNEYRKRFGLKPYTSF
QEFTGEKEMAAELEELYGDIDALEFYPGLMLEKCQPNSLFGESMIEMGAPFSLKGLLGNP
ICSPEYWKPSTFGGDVGFNIVNTASLKKLVCLNTKTCPYVSFRVPDYPGDDGSVFVRPST
EL



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min