Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

24715, Ren

Enzyme Number

3.4.23.15

RLRdb entry

RL00475

Organisms

Rat (10116)

Synonyms

RATRENAA|RENAA|Ren1;
Ren;
renin;
renin 1 structural

Description

renin

Xrefs

RGD:3554| RATMAP:34360| Ensembl:ENSRNOG00000002937

Chromosome

13 : 13q13

Links to iHOP

24715

Sequence Information

Nucleotide sequence

>24715 : length: 1209
atgggcgggaggaggatgcctctctgggcactcttgttgctctggacctcttgtagcttc
agtctcccgacagacacagccagctttggacgaatcttgctcaagaaaatgccctcggtc
cgggaaatcctggaggagcggggagtagacatgaccaggatcagtgctgaatggggtgaa
ttcatcaagaagtcttcctttaccaatgttacctcccccgtggtcctcaccaactacttg
gatacccagtactatggtgagatcggcattggtaccccatcccagaccttcaaagtcatc
tttgacacgggttcagccaacctctgggtgccctccaccaagtgtggtcccctctacact
gcctgtgagattcacaacctctatgactcctcggaatcctctagctacatggagaatggg
actgaattcaccatccactatggatcagggaaggtcaaaggtttcctcagccaagatgtg
gtaactgtgggtggaatcattgtgacacagacctttggagaggtcaccgagctgcccctg
atacccttcatgctggccaagtttgacggggttctgggcatgggcttccctgctcaggct
gttgatggagtcatccctgtcttcgaccacattctctcccagagggtgctaaaggaggaa
gtgttttctgtctactacagcagggagtcccacctgctggggggcgaagtggtgctggga
ggcagtgaccctcaacattaccagggcaactttcactacgtgagcatcagcaaggccggc
tcctggcagatcaccatgaagggggtctctgtggggcctgccaccttgttgtgtgaggag
ggctgtatggcagtggtggacactggcacatcctatatctcgggccctaccagctccctg
cagttgatcatgcaagccctgggagtcaaagagaagagagcaaataattacgttgtgaac
tgtagccaggtacccaccctccccgacatctccttctacctgggaggcaggacctacact
ctcagcaacatggactatgtgcaaaagaatcccttcaggaacgatgacctgtgcatactg
gctctccaaggcctggacatcccaccacccactgggcctgtctgggtcctgggtgccacc
ttcatccgcaagttctatacagagttcgaccggcataacaatcgcatcgggttcgccttg
gcccgctaa

Protein sequence

>24715 : length: 402
MGGRRMPLWALLLLWTSCSFSLPTDTASFGRILLKKMPSVREILEERGVDMTRISAEWGE
FIKKSSFTNVTSPVVLTNYLDTQYYGEIGIGTPSQTFKVIFDTGSANLWVPSTKCGPLYT
ACEIHNLYDSSESSSYMENGTEFTIHYGSGKVKGFLSQDVVTVGGIIVTQTFGEVTELPL
IPFMLAKFDGVLGMGFPAQAVDGVIPVFDHILSQRVLKEEVFSVYYSRESHLLGGEVVLG
GSDPQHYQGNFHYVSISKAGSWQITMKGVSVGPATLLCEEGCMAVVDTGTSYISGPTSSL
QLIMQALGVKEKRANNYVVNCSQVPTLPDISFYLGGRTYTLSNMDYVQKNPFRNDDLCIL
ALQGLDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALAR



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min