Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

24813, Tat

Enzyme Number

2.6.1.5

RLRdb entry

RL00379

Organisms

Rat (10116)

Synonyms

Tat;
tyrosine aminotransferase;
-

Description

tyrosine aminotransferase

Xrefs

RGD:3820| RATMAP:34470| Ensembl:ENSRNOG00000016348

Chromosome

19 : 19q11-q12

Links to iHOP

24813

Sequence Information

Nucleotide sequence

>24813 : length: 1365
atggactcctacgtgattcagacggatgtcgacgacagcttgtcctcagttctggatgtg
catgtcaatattggtgggagaaactcggtacaaggaagaaagaaaggcaggaaggccaga
tgggacgtgagaccctctgacatgtccaataagaccttcaatcccatccgagccatcgtg
gacaacatgaaggtgcagcccaatccgaacaagaccgtgatttctctgtcaattggggac
cctactgtgtttgggaacctgcctacagaccctgaagttacccaagccatgaaagatgcc
ctggactcggggaagtacaatggctatgccccgtccatcggctacctatccagtcgggag
gaggtcgcttcttactaccactgtcatgaggctcctctggaagctaaggatgtcattctg
acaagcggctgcagtcaggccattgagctatgtctagctgtgttggccaatcctggacaa
aacatcctcattccaaggcccgggttttccctctataggactttggctgagtctatggga
attgaggtcaagctctacaatctcctgcccgagaagtcttgggaaattgacctaaaacaa
ctggaatctctgatcgatgaaaaaacagcgtgtcttgttgtcaacaacccatccaatccc
tgtggctccgtgttcagtaagcggcaccttcagaagattttggcagtggctgaaaggcag
tgtgtccccatcttagctgacgagatctatggtgacatggtgttttcagattgcaaatac
gaaccactggccaacctcagcaccaatgttcccatcctgtcctgtggtgggctggccaag
cgctggctggttcctggctggaggttgggctggatcctcattcatgatcgaagagacatt
tttggcaatgagattcgagacgggctggtgaaactgagtcagcggatcctgggaccatgc
accatagtccagggtgctctgaagagcatccttcagcgaacccctcaggagttctatcac
gacacgttaagcttcctcaagtccaatgcggacctctgctatggggcactggctgccatc
cctggactccagccggtccgcccttctggagccatgtaccttatggtgggaattgagatg
gagcatttcccggaattcgagaacgacgtggagttcacagagcggttgattgcggagcag
gctgtccactgtctcccagcaacgtgcttcgagtacccaaatttcttccgagtggtcatc
acagtccccgaggtgatgatgctggaggcttgtagccggatccaggagttctgtgaacag
cactaccactgtgctgaaggcagccaggaggagtgtgacaaataa

Protein sequence

>24813 : length: 454
MDSYVIQTDVDDSLSSVLDVHVNIGGRNSVQGRKKGRKARWDVRPSDMSNKTFNPIRAIV
DNMKVQPNPNKTVISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGYLSSRE
EVASYYHCHEAPLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMG
IEVKLYNLLPEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQ
CVPILADEIYGDMVFSDCKYEPLANLSTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDI
FGNEIRDGLVKLSQRILGPCTIVQGALKSILQRTPQEFYHDTLSFLKSNADLCYGALAAI
PGLQPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLIAEQAVHCLPATCFEYPNFFRVVI
TVPEVMMLEACSRIQEFCEQHYHCAEGSQEECDK



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min