Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

2538, G6PC

Enzyme Number

3.1.3.9

RLRdb entry

RL00150

Organisms

Human (9606)

Synonyms

G6PT|GSD1|GSD1a|MGC163350;
G6PC;
glucose-6-phosphatase, catalytic subunit;
glucose-6-phosphatase, catalytic (glycogen storage disease type I, von Gierke disease)|glycogen storage disease type I, von Gierke disease

Description

glucose-6-phosphatase, catalytic subunit

Xrefs

HGNC:4056| MIM:232200| Ensembl:ENSG00000131482| HPRD:01983

Chromosome

17 : 17q21

Links to iHOP

2538

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

2538 2308 PMID: 11672436

Sequence Information

Nucleotide sequence

>2538 : length: 1074
atggaggaaggaatgaatgttctccatgactttgggatccagtcaacacattacctccag
gtgaattaccaagactcccaggactggttcatcttggtgtccgtgatcgcagacctcagg
aatgccttctacgtcctcttccccatctggttccatcttcaggaagctgtgggcattaaa
ctcctttgggtagctgtgattggagactggctcaacctcgtctttaagtggattctcttt
ggacagcgtccatactggtgggttttggatactgactactacagcaacacttccgtgccc
ctgataaagcagttccctgtaacctgtgagactggaccagggagcccctctggccatgcc
atgggcacagcaggtgtatactacgtgatggtcacatctactctttccatctttcaggga
aagataaagccgacctacagatttcggtgcttgaatgtcattttgtggttgggattctgg
gctgtgcagctgaatgtctgtctgtcacgaatctaccttgctgctcattttcctcatcaa
gttgttgctggagtcctgtcaggcattgctgttacagaaactttcagccacatccacagc
atctataatgccagcctcaagaaatattttctcattaccttcttcctgttcagcttcgcc
atcggattttatctgctgctcaagggactgggtgtagacctcctgtggactctggagaaa
gcccagaggtggtgcgagcagccagaatgggtccacattgacaccacaccctttgccagc
ctcctcaagaacctgggcacgctctttggcctggggctggctctcaactccagcatgtac
agggagagctgcaaggggaaactcagcaagtggctcccattccgcctcagctctattgta
gcctccctcgtcctcctgcacgtctttgactccttgaaacccccatcccaagtcgagctg
gtcttctacgtcttgtccttctgcaagagtgcggtagtgcccctggcatccgtcagtgtc
atcccctactgcctcgcccaggtcctgggccagccgcacaagaagtcgttgtaa

Protein sequence

>2538 : length: 357
MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIK
LLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHA
MGTAGVYYVMVTSTLSIFQGKIKPTYRFRCLNVILWLGFWAVQLNVCLSRIYLAAHFPHQ
VVAGVLSGIAVTETFSHIHSIYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEK
AQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWLPFRLSSIV
ASLVLLHVFDSLKPPSQVELVFYVLSFCKSAVVPLASVSVIPYCLAQVLGQPHKKSL



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min