Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

25428, Cyp7a1

Enzyme Number

1.14.13.17

RLRdb entry

RL00394

Organisms

Rat (10116)

Synonyms

CHAP|CYP7|CYP7S1;
Cyp7a1;
cytochrome P450, family 7, subfamily a, polypeptide 1;
Cytochrom P450 (cholesterol hydroxylase 7 alpha)|cholesterol 7-alpha hydroxylase|cytochrome P450 (cholesterol hydroxylase 7 alpha)|cytochrome P450, 7a1

Description

cytochrome P450, family 7, subfamily a, polypeptide 1

Xrefs

RGD:2482| RATMAP:41313| Ensembl:ENSRNOG00000009488

Chromosome

5 : 5q12

Links to iHOP

25428

Sequence Information

Nucleotide sequence

>25428 : length: 1512
atgatgactatttctttgatttggggaattgccgtgttggtgagctgttgcatatggttt
attgttggaataaggagaaggaaagctggtgaacctcctttggagaacgggttgattccg
tacctgggctgtgctctgaaatttggatctaatcctcttgagttcctaagagctaatcaa
aggaagcatggtcacgtttttacctgcaaactgatggggaaatatgtccatttcatcaca
aactccctgtcataccacaaagtcttatgtcatggaaaatattttgactggaaaaaattt
cattacactacttctgcgaaggcatttggacacagaagcattgacccaaatgatggaaat
accacggaaaatataaacaacacttttaccaaaaccctccagggagatgctctgtgttca
ctttctgaagccatgatgcaaaacctccaatctgtcatgagacctcctggccttcctaaa
tcaaagagcaatgcctgggtcacggaagggatgtatgccttctgttaccgagtgatgttt
gaagctggctatctaacactgtttggcagagatatttcaaagacagacacacaaaaagca
cttattctaaacaaccttgacaacttcaaacaatttgaccaagtctttccggcactggtg
gcaggccttcctattcacttgttcaagaccgcacataaagctcgggaaaagctggctgag
ggattgaagcacaagaacctgtgtgtgagggaccaggtctctgaactgatccgtctacgt
atgtttctcaatgacacgctctccacctttgacgacatggagaaggccaagacgcacctc
gctattctctgggcatctcaagcaaacaccattcctgcaaccttttggagcttatttcaa
atgatcaggagtcctgaagcaatgaaagcagcctctgaagaagtgagtggagctttacag
agtgctggccaagagctcagctctggagggagtgccatttacttggatcaagtgcaactg
aatgacctgccggtactagacagcatcatcaaggaggctctgaggctttccagtgcatcc
ttgaatatccgcacagctaaggaggacttcactctccatcttgaggacggttcctataac
atccgaaaagatgacatgatagctctttatccacagttaatgcacttggatcctgaaatc
tacccagaccctttgactttcaaatatgaccggtaccttgatgaaagcgggaaagcaaag
accaccttctacagtaatggaaacaagctgaagtgtttctacatgcccttcggatcaggc
gcgacaatatgtcctggaagactctttgccgtccaagaaatcaagcagtttttgatcctg
atgctctcctgctttgaactggagtttgtggagagccaagtcaagtgtccccctctagac
cagtcccgggcaggcttgggaattttgccaccactacatgatattgagtttaaatataaa
ctgaaacactga

Protein sequence

>25428 : length: 503
MMTISLIWGIAVLVSCCIWFIVGIRRRKAGEPPLENGLIPYLGCALKFGSNPLEFLRANQ
RKHGHVFTCKLMGKYVHFITNSLSYHKVLCHGKYFDWKKFHYTTSAKAFGHRSIDPNDGN
TTENINNTFTKTLQGDALCSLSEAMMQNLQSVMRPPGLPKSKSNAWVTEGMYAFCYRVMF
EAGYLTLFGRDISKTDTQKALILNNLDNFKQFDQVFPALVAGLPIHLFKTAHKAREKLAE
GLKHKNLCVRDQVSELIRLRMFLNDTLSTFDDMEKAKTHLAILWASQANTIPATFWSLFQ
MIRSPEAMKAASEEVSGALQSAGQELSSGGSAIYLDQVQLNDLPVLDSIIKEALRLSSAS
LNIRTAKEDFTLHLEDGSYNIRKDDMIALYPQLMHLDPEIYPDPLTFKYDRYLDESGKAK
TTFYSNGNKLKCFYMPFGSGATICPGRLFAVQEIKQFLILMLSCFELEFVESQVKCPPLD
QSRAGLGILPPLHDIEFKYKLKH



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min