Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

2673, GFPT1

Enzyme Number

2.6.1.16

RLRdb entry

RL00275

Organisms

Human (9606)

Synonyms

GFA|GFAT|GFAT1|GFAT1m|GFPT;
GFPT1;
glutamine-fructose-6-phosphate transaminase 1;
glucosamine-fructose-6-phosphate aminotransferase|glutamine: fructose-6-phosphate amidotransferase-1

Description

glutamine-fructose-6-phosphate transaminase 1

Xrefs

HGNC:4241| MIM:138292| Ensembl:ENSG00000198380| HPRD:00702

Chromosome

2 : 2p13

Links to iHOP

2673

Sequence Information

Nucleotide sequence

>2673 : length: 2046
atgtgtggtatatttgcttacttaaactaccatgttcctcgaacgagacgagaaatcctg
gagaccctaatcaaaggccttcagagactggagtacagaggatatgattctgctggtgtg
ggatttgatggaggcaatgataaagattgggaagccaatgcctgcaaaacccagcttatt
aagaagaaaggaaaagttaaggcactggatgaagaagttcacaagcaacaagatatggat
ttggatatagaatttgatgtacaccttggaatagctcatacccgttgggcaacacatgga
gaacccagtcctgtcaatagccacccccagcgctctgataaaaataatgaatttatcgtt
attcacaatggaatcatcaccaactacaaagacttgaaaaagtttttggaaagcaaaggc
tatgacttcgaatctgaaacagacacagagacaattgccaagctcgttaagtatatgtat
gacaatcgggaaagtcaagataccagctttactaccttggtggagagagttatccaacaa
ttggaaggtgcttttgcacttgtgtttaaaagtgttcattttcccgggcaagcagttggc
acaaggcgaggtagccctctgttgattggtgtacggagtgaacataaactttctactgat
cacattcctatactctacagaacaggcaaagacaagaaaggaagctgcaatctctctcgt
gtggacagcacaacctgccttttcccggtggaagaaaaagcagtggagtattactttgct
tctgatgcaagtgctgtcatagaacacaccaatcgcgtcatctttctggaagatgatgat
gttgcagcagtagtggatggacgtctttctatccatcgaattaaacgaactgcaggagat
caccccggacgagctgtgcaaacactccagatggaactccagcagatcatgaagggcaac
ttcagttcatttatgcagaaggaaatatttgagcagccagagtctgtcgtgaacacaatg
agaggaagagtcaactttgatgactatactgtgaatttgggtggtttgaaggatcacata
aaggagatccagagatgccggcgtttgattcttattgcttgtggaacaagttaccatgct
ggtgtagcaacacgtcaagttcttgaggagctgactgagttgcctgtgatggtggaacta
gcaagtgacttcctggacagaaacacaccagtctttcgagatgatgtttgctttttcctt
agtcaatcaggtgagacagcagatactttgatgggtcttcgttactgtaaggagagagga
gctttaactgtggggatcacaaacacagttggcagttccatatcacgggagacagattgt
ggagttcatattaatgctggtcctgagattggtgtggccagtacaaaggcttataccagc
cagtttgtatcccttgtgatgtttgcccttatgatgtgtgatgatcggatctccatgcaa
gaaagacgcaaagagatcatgcttggattgaaacggctgcctgatttgattaaggaagta
ctgagcatggatgacgaaattcagaaactagcaacagaactttatcatcagaagtcagtt
ctgataatgggacgaggctatcattatgctacttgtcttgaaggggcactgaaaatcaaa
gaaattacttatatgcactctgaaggcatccttgctggtgaattgaaacatggccctctg
gctttggtggataaattgatgcctgtgatcatgatcatcatgagagatcacacttatgcc
aagtgtcagaatgctcttcagcaagtggttgctcggcaggggcggcctgtggtaatttgt
gataaggaggatactgagaccattaagaacacaaaaagaacgatcaaggtgccccactca
gtggactgcttgcagggcattctcagcgtgatccctttacagttgctggctttccacctt
gctgtgctgagaggctatgatgttgatttcccacggaatcttgccaaatctgtgactgta
gagtga

Protein sequence

>2673 : length: 681
MCGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGFDGGNDKDWEANACKTQLI
KKKGKVKALDEEVHKQQDMDLDIEFDVHLGIAHTRWATHGEPSPVNSHPQRSDKNNEFIV
IHNGIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDNRESQDTSFTTLVERVIQQ
LEGAFALVFKSVHFPGQAVGTRRGSPLLIGVRSEHKLSTDHIPILYRTGKDKKGSCNLSR
VDSTTCLFPVEEKAVEYYFASDASAVIEHTNRVIFLEDDDVAAVVDGRLSIHRIKRTAGD
HPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHI
KEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFL
SQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTS
QFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSV
LIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYA
KCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHL
AVLRGYDVDFPRNLAKSVTVE



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min