Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

29527, Ptgs2

Enzyme Number

1.14.99.1

RLRdb entry

RL00448

Organisms

Rat (10116)

Synonyms

COX-2|Cox2;
Ptgs2;
prostaglandin-endoperoxide synthase 2;
cyclooxygenase 2|cyclooxygenase-2

Description

prostaglandin-endoperoxide synthase 2

Xrefs

RGD:620349| Ensembl:ENSRNOG00000002525

Chromosome

13 : 13q21

Links to iHOP

29527

Sequence Information

Nucleotide sequence

>29527 : length: 1815
atgctcttccgagctgtgctgctctgcgctgccctggcgctcagccatgcagcaaatcct
tgctgttccaacccatgtcaaaaccgtggtgaatgtatgagcataggatttgaccaatat
aaatgtgactgtacccggactggattctacggtgaaaactgtactacgcctgagtttctg
acaagaatcaaattactgctgaagcccaccccaaacacagtacactacatcctgacccac
ttcaagggagtctggaacattgtgaacaacattcccttccttcggaattcaatcatgaga
tacgtgttgacgtccagatcacatttgattgacagcccaccaacttacaatgtgcactac
ggttacaaaagttgggaagctttctccaacctctcctactacaccagggcccttcctcct
gtggctgatgactgcccaactcccatgggtgtgaaaggaaataaggaacttcctgattca
aaagaagttctggaaaaggttcttctgaggagagagttcatcccggatccccaaggcaca
aatatgatgttcgcattctttgcccagcacttcactcatcagtttttcaagacagatcag
aagcgaggacctgggttcacccgaggactgggccatggagtggacttaaatcatgtttac
ggtgaaactctagacagacaacataaacttcgacttttccaggatggaaaattgaaatat
caggtcatcggtggagaggtgtatcctcccacagtcaaagacactcaggtagacatgatc
taccctccccacgtccctgagcacctgcggttcgctgtggggcaggaagtctttggtctg
gtgccgggtctgatgatgtatgctaccatctggcttcgggagcacaacagagtgtgtgat
atactcaaacaggagcatcctgagtgggatgacgagcgactgttccaaaccagcaggctc
atactgataggagagacgatcaagatagtgatcgaagactacgtgcaacacctgagcggt
taccacttcaaactcaagttcgacccagagctgcttttcaaccagcagttccagtatcag
aaccgcattgcctctgaattcaacacactctatcactggcatccgctgctgccggacacc
ttcaacattgaagaccaggagtacactttcaaacagtttctctacaacaactccatcctc
cttgaacacggacttgctcactttgttgagtcattcaccagacagattgctggccgggtt
gctgggggaaggaatgttccaatcgctgtacaagcagtggcaaaggcctccattgaccag
agcagagagatgaaataccagtctctcaatgagtaccgcaaacgcttctccctgaaacct
tacacatcgtttgaagaacttacaggagagaaagaaatggctgcagagttgaaagccctc
taccatgacatcgatgccatggaactgtatcccgccctgctggtggaaaagcctcgtcca
gatgctatctttggggagaccatggtagaacttggagctccattctccttgaaaggcctt
atgggtaatcccatctgttctcctcaatactggaaacctagcaccttcggaggagaagtg
ggttttaggatcatcaacactgcctcaattcagtctctcatctgcaataatgtgaaaggg
tgtccctttgcctctttcaatgtgcaagacccgcagcctaccaagacagccaccatcaac
gcaagtgcctcccactccagactagatgacattaaccctacagtactaatcaaaaggcgt
tcaactgagctgtaa

Protein sequence

>29527 : length: 604
MLFRAVLLCAALALSHAANPCCSNPCQNRGECMSIGFDQYKCDCTRTGFYGENCTTPEFL
TRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRNSIMRYVLTSRSHLIDSPPTYNVHY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDPQGT
NMMFAFFAQHFTHQFFKTDQKRGPGFTRGLGHGVDLNHVYGETLDRQHKLRLFQDGKLKY
QVIGGEVYPPTVKDTQVDMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
ILKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIASEFNTLYHWHPLLPDTFNIEDQEYTFKQFLYNNSILLEHGLAHFVESFTRQIAGRV
AGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKAL
YHDIDAMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEV
GFRIINTASIQSLICNNVKGCPFASFNVQDPQPTKTATINASASHSRLDDINPTVLIKRR
STEL



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min