Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

3028, HSD17B10

Enzyme Number

1.1.1.35

RLRdb entry

RL00006

Organisms

Human (9606)

Synonyms

RP3-339A18.2;
17b-HSD10|ABAD|CAMR|ERAB|HADH2|HCD2|MHBD|MRX17|MRX31|MRXS10|SCHAD;
HSD17B10;
hydroxysteroid (17-beta) dehydrogenase 10;
17-beta-hydroxysteroid dehydrogenase type 10|3-hydroxy-2-methylbutyryl-CoA dehydrogenase|AB-binding alcohol dehydrogenase|OTTHUMP00000023348|OTTHUMP00000023349|amyloid-beta binding polypeptide|amyloid-beta peptide binding alcohol dehydrogenase|mental retardation, X-linked, syndromic 11|short chain L-3-hydroxyacyl-CoA dehydrogenase type 2|short chain type dehydrogenase/reductase XH98G2|type 10 17b-HSD|type 10 17beta-hydroxysteroid dehydrogenase

Description

hydroxysteroid (17-beta) dehydrogenase 10

Xrefs

HGNC:4800| MIM:300256| Ensembl:ENSG00000072506| HPRD:02223

Chromosome

X : Xp11.2

Links to iHOP

3028

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

3028 351 PMID: 9338779
3028 351 PMID: 16189514
3028 351 PMID: 10371197

Sequence Information

Nucleotide sequence

>3028 : length: 759
atggcagcagcgtgtcggagcgtgaagggcctggtggcggtaataaccggaggagcctcg
ggcctgggcctggccacggcggagcgacttgtggggcagggagcctctgctgtgcttctg
gacctgcccaactcgggtggggaggcccaagccaagaagttaggaaacaactgcgttttc
gccccagccgacgtgacctctgagaaggatgtgcaaacagctctggctctagcaaaagga
aagtttggccgtgtggatgtagctgtcaactgtgcaggcatcgcggtggctagcaagacg
tacaacttaaagaagggccagacccataccttggaagacttccagcgagttcttgatgtg
aatctcatgggcaccttcaatgtgatccgcctggtggctggtgagatgggccagaatgaa
ccagaccagggaggccaacgtggggtcatcatcaacactgccagtgtggctgccttcgag
ggtcaggttggacaagctgcatactctgcttccaaggggggaatagtgggcatgacactg
cccattgctcgggatctggctcccataggtctgtttggcaccccactgctgaccagcctc
ccagagaaagtgtgcaacttcttggccagccaagtgcccttccctagccgactgggtgac
cctgctgagtatgctcacctcgtacaggccatcatcgagaacccattcctcaatggagag
gtcatccggctggatggggccattcgtatgcagccttga

Protein sequence

>3028 : length: 252
MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVF
APADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDV
NLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTL
PIARDLAPIGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGE
VIRLDGAIRMQP



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min