Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

3098, HK1

Enzyme Number

2.7.1.1

RLRdb entry

RL00010

Organisms

Human (9606)

Synonyms

HK1-ta|HK1-tb|HK1-tc|HKI|HXK1;
HK1;
hexokinase 1;
OTTHUMP00000019725|brain form hexokinase|glycolytic enzyme

Description

hexokinase 1

Xrefs

HGNC:4922| MIM:142600| Ensembl:ENSG00000156515| HPRD:00809

Chromosome

10 : 10q22

Links to iHOP

3098

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

3098 7416 PMID: 16189514
3098 7416 PMID: 10978502
3098 2026 PMID: 16169070
3098 7417 PMID: 8420959

Sequence Information

Nucleotide sequence

>3098 : length: 2754
atgatcgccgcgcagctcctggcctattacttcacggagctgaaggatgaccaggtcaaa
aagattgacaagtatctctatgccatgcggctctccgatgaaactctcatagatatcatg
actcgcttcaggaaggagatgaagaatggcctctcccgggattttaatccaacagccaca
gtcaagatgttgccaacattcgtaaggtccattcctgatggctctgaaaagggagatttc
attgccctggatcttggtgggtcttcctttcgaattctgcgggtgcaagtgaatcatgag
aaaaaccagaatgttcacatggagtccgaggtttatgacaccccagagaacatcgtgcac
ggcagtggaagccagctttttgatcatgttgctgagtgcctgggagatttcatggagaaa
aggaagatcaaggacaagaagttacctgtgggattcacgttttcttttccttgccaacaa
tccaaaatagatgaggccatcctgatcacctggacaaagcgatttaaagcgagcggagtg
gaaggagcagatgtggtcaaactgcttaacaaagccatcaaaaagcgaggggactatgat
gccaacatcgtagctgtggtgaatgacacagtgggcaccatgatgacctgtggctatgac
gaccagcactgtgaagtcggcctgatcatcggcactggcaccaatgcttgctacatggag
gaactgaggcacattgatctggtggaaggagacgaggggaggatgtgtatcaatacagaa
tggggagcctttggagacgatggatcattagaagacatccggacagagtttgacagggag
atagaccggggatccctcaaccctggaaaacagctgtttgagaagatggtcagtggcatg
tacttgggagagctggttcgactgatcctagtcaagatggccaaggagggcctcttattt
gaagggcggatcaccccggagctgctcacccgagggaagtttaacaccagtgatgtgtca
gccatcgaaaagaataaggaaggcctccacaatgccaaagaaatcctgacccgcctggga
gtggagccgtccgatgatgactgtgtctcagtccagcacgtttgcaccattgtctcattt
cgctcagccaacttggtggctgccacactgggcgccatcttgaaccgcctgcgtgataac
aagggcacacccaggctgcggaccacggttggtgtcgacggatctctttacaagacgcac
ccacagtattcccggcgtttccacaagactctaaggcgcttggtgccagactccgatgtg
cgcttcctcctctcggagagtggcagcggcaagggggctgccatggtgacggcggtggcc
taccgcttggccgagcagcaccggcagatagaggagaccctggctcatttccacctcacc
aaggacatgctgctggaggtgaagaagaggatgcgggccgagatggagctggggctgagg
aagcagacgcacaacaatgccgtggttaagatgctgccctccttcgtccggagaactccc
gacgggaccgagaatggtgacttcttggccctggatcttggaggaaccaatttccgtgtg
ctgctggtgaaaatccgtagtgggaaaaagagaacggtggaaatgcacaacaagatctac
gccattcctattgaaatcatgcagggcactggggaagagctgtttgatcacattgtctcc
tgcatctctgacttcttggactacatggggatcaaaggccccaggatgcctctgggcttc
acgttctcatttccctgccagcagacgagtctggacgcgggaatcttgatcacgtggaca
aagggttttaaggcaacagactgcgtgggccacgatgtagtcaccttactaagggatgcg
ataaaaaggagagaggaatttgacctggacgtggtggctgtggtcaacgacacagtgggc
accatgatgacctgtgcttatgaggagcccacctgtgaggttggactcattgttgggacc
ggcagcaatgcctgctacatggaggagatgaagaacgtggagatggtggagggggaccag
gggcagatgtgcatcaacatggagtggggggcctttggggacaacgggtgtctggatgat
atcaggacacactacgacagactggtggacgaatattccctaaatgctgggaaacaaagg
tatgagaagatgatcagtggtatgtacctgggtgaaatcgtccgcaacatcttaatcgac
ttcaccaagaagggattcctcttccgagggcagatctctgagacgctgaagacccggggc
atctttgagaccaagtttctctctcagatcgagagtgaccgattagcactgctccaggtc
cgggctatcctccagcagctaggtctgaatagcacctgcgatgacagtatcctcgtcaag
acagtgtgcggggtggtgtccaggagggccgcacagctgtgtggcgcaggcatggctgcg
gttgtggataagatccgcgagaacagaggactggaccgtctgaatgtgactgtgggagtg
gacgggacactctacaagcttcatccacacttctccagaatcatgcaccagacggtgaag
gaactgtcaccaaaatgtaacgtgtccttcctcctgtctgaggatggcagcggcaagggg
gccgccctcatcacggccgtgggcgtgcggttacgcacagaggcaagcagctaa

Protein sequence

>3098 : length: 917
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVH
GSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLG
VEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLT
KDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDD
IRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAA
VVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLRTEASS



Basic Information

Gene ID

3099, HK2

Enzyme Number

2.7.1.1

RLRdb entry

RL00010

Organisms

Human (9606)

Synonyms

DKFZp686M1669|HKII|HXK2;
HK2;
hexokinase 2;
hexokinase-2, muscle

Description

hexokinase 2

Xrefs

HGNC:4923| MIM:601125| Ensembl:ENSG00000159399| HPRD:03080

Chromosome

2 : 2p13

Links to iHOP

3099

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

3099 7709 PMID: 11068878
3099 5581 PMID: 12663490
3099 5730 PMID: 11068878
3099 3487 PMID: 11068878
3099 29979 PMID: 16189514

Sequence Information

Nucleotide sequence

>3099 : length: 2754
atgattgcctcgcatctgcttgcctacttcttcacggagctcaaccatgaccaagtgcag
aaggttgaccagtatctctaccacatgcgcctctctgatgagaccctcttggagatctct
aagcggttccgcaaggagatggagaaagggcttggagccaccactcaccctactgcagca
gtgaagatgctgcccacctttgtgaggtccactccagatgggacagaacacggagagttc
ctggctctggatcttggagggaccaacttccgtgtgctttgggtgaaagtaacggacaat
gggctccagaaggtggagatggagaatcagatctatgccatccctgaggacatcatgcga
ggcagtggcacccagctgtttgaccacattgccgaatgcctggctaacttcatggataag
ctacaaatcaaagacaagaagctcccactgggttttaccttctcgttcccctgccaccag
actaaactagacgagagtttcctggtctcatggaccaagggattcaagtccagtggagtg
gaaggcagagacgttgtggctctgatccggaaggccatccagaggagaggggactttgat
atcgacattgtggctgtggtgaatgacacagttgggaccatgatgacctgtggttatgat
gaccacaactgtgagattggtctcattgtgggcacgggcagcaacgcctgctacatggaa
gagatgcgccacatcgacatggtggaaggcgatgaggggcggatgtgtatcaatatggag
tggggggccttcggggacgatggctcgctcaacgacattcgcactgagtttgaccaggag
attgacatgggctcactgaacccgggaaagcaactgtttgagaagatgatcagtgggatg
tacatgggggagctggtgaggcttatcctggtgaagatggccaaggaggagctgctcttt
ggggggaagctcagcccagagcttctcaacaccggtcgctttgagaccaaagacatctca
gacattgaaggggagaaggatggcatccggaaggcccgtgaggtcctgatgcggttgggc
ctggacccgactcaggaggactgcgtggccactcaccggatctgccagatcgtgtccaca
cgctccgccagcctgtgcgcagccaccctggccgccgtgctgcagcgcatcaaggagaac
aaaggcgaggagcggctgcgctctactattggggtcgacggttccgtctacaagaaacac
ccccattttgccaagcgtctacataagaccgtgcggcggctggtgcccggctgcgatgtc
cgcttcctccgctccgaggatggcagtggcaaaggtgcagccatggtgacagcagtggct
taccggctggccgatcaacaccgtgcccgccagaagacattagagcatctgcagctgagc
catgaccagctgctggaggtcaagaggaggatgaaggtagaaatggagcgaggtctgagc
aaggagactcatgccagtgcccccgtcaagatgctgcccacctacgtgtgtgctaccccg
gacggcacagagaaaggggacttcttggccttggaccttggaggaacaaatttccgggtc
ctgctggtccgtgttcggaatgggaagtggggtggagtggagatgcacaacaagatctac
gccatcccgcaggaggtcatgcacggcaccggggacgagctctttgaccacattgtccag
tgcatcgcggacttcctcgagtacatgggcatgaagggcgtgtccctgcctctgggtttt
accttctccttcccctgccagcagaacagcctggacgagagcatcctcctcaagtggaca
aaaggcttcaaggcatctggctgcgagggcgaggacgtggtgaccctgctgaaggaagcg
atccaccggcgagaggagtttgacctggatgtggttgctgtggtgaacgacacagtcgga
actatgatgacctgtggctttgaagaccctcactgtgaagttggcctcattgttggcacg
ggcagcaatgcctgctacatggaggagatgcgcaacgtggaactggtggaaggagaagag
gggcggatgtgtgtgaacatggaatggggggccttcggggacaatggatgcctagatgac
ttccgcacagaatttgatgtggctgtggatgagctttcactcaaccccggcaagcagagg
ttcgagaaaatgatcagtggaatgtacctgggtgagattgtccgtaacattctcatcgat
ttcaccaagcgtggactactcttccgaggccgcatctcagagcggctcaagacaaggggc
atctttgaaaccaagttcttgtctcagattgagagtgactgcctggccctgctgcaagtc
cgagccatcctgcaacacttagggcttgagagcacctgtgacgacagcatcattgttaag
gaggtgtgcactgtggtggcccggcgggcagcccagctctgtggcgcaggcatggccgct
gtggtggacaggatacgagaaaaccgtgggctggacgctctcaaagtgacagtgggtgtg
gatgggaccctctacaagctacatcctcactttgccaaagtcatgcatgagacagtgaag
gacctggctccgaaatgtgatgtgtctttcctgcagtcagaggatggcagcgggaagggg
gcggcgctcatcactgctgtggcctgccgcatccgtgaggctggacagcgatag

Protein sequence

>3099 : length: 917
MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAA
VKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMR
GSGTQLFDHIAECLANFMDKLQIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGV
EGRDVVALIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDHNCEIGLIVGTGSNACYME
EMRHIDMVEGDEGRMCINMEWGAFGDDGSLNDIRTEFDQEIDMGSLNPGKQLFEKMISGM
YMGELVRLILVKMAKEELLFGGKLSPELLNTGRFETKDISDIEGEKDGIRKAREVLMRLG
LDPTQEDCVATHRICQIVSTRSASLCAATLAAVLQRIKENKGEERLRSTIGVDGSVYKKH
PHFAKRLHKTVRRLVPGCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTLEHLQLS
HDQLLEVKRRMKVEMERGLSKETHASAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRV
LLVRVRNGKWGGVEMHNKIYAIPQEVMHGTGDELFDHIVQCIADFLEYMGMKGVSLPLGF
TFSFPCQQNSLDESILLKWTKGFKASGCEGEDVVTLLKEAIHRREEFDLDVVAVVNDTVG
TMMTCGFEDPHCEVGLIVGTGSNACYMEEMRNVELVEGEEGRMCVNMEWGAFGDNGCLDD
FRTEFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRG
IFETKFLSQIESDCLALLQVRAILQHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAA
VVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDGSGKG
AALITAVACRIREAGQR



Basic Information

Gene ID

3101, HK3

Enzyme Number

2.7.1.1

RLRdb entry

RL00010

Organisms

Human (9606)

Synonyms

HKIII|HXK3;
HK3;
hexokinase 3 (white cell);
ATP:D-hexose 6-phosphotransferase|hexokinase 3

Description

hexokinase 3 (white cell)

Xrefs

HGNC:4925| MIM:142570| Ensembl:ENSG00000160883| HPRD:00806

Chromosome

5 : 5q35.2

Links to iHOP

3101

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

3101 7709 PMID: 11068878
3101 2896 PMID: 16189514
3101 2896 PMID: 11068878
3101 3952 PMID: 11068878
3101 5730 PMID: 11068878
3101 3487 PMID: 16189514
3101 3487 PMID: 11068878
3101 27306 PMID: 11068878

Sequence Information

Nucleotide sequence

>3101 : length: 2772
atggactccattgggtcttcagggttgcggcagggggaagaaaccctgagttgctctgag
gagggcttgcccgggccctcagacagctcagagctggtgcaggagtgcctgcagcagttc
aaggtgacaagggcacagctacagcagatccaagccagcctcttgggttccatggagcag
gcgctgaggggacaggccagccctgcccctgcggtccggatgctgcctacatacgtgggg
tccaccccacatggcactgagcaaggagacttcgtggtgctggagctgggggccacaggg
gcctcactgcgtgttttgtgggtgactctaactggcattgaggggcatagggtggagccc
agaagccaggagtttgtgatcccccaagaggtgatgctgggtgctggccagcagctcttt
gactttgctgcccactgcctgtctgagttcctggatgcgcagcctgtgaacaaacagggt
ctgcagcttggcttcagcttctctttcccttgtcaccagacgggcttggacaggagcacc
ctcatttcctggaccaaaggttttaggtgcagtggtgtggaaggccaggatgtggtccag
ctgctgagagatgccattcggaggcagggggcctacaacatcgacgtggttgctgtggtg
aacgacacagtgggcaccatgatgggctgtgagccgggggtcaggccgtgtgaggttggg
ctagttgtagacacgggcaccaacgcgtgttacatggaggaggcacggcatgtggcagtg
ctggacgaagaccggggccgcgtctgcgtcagcgtcgagtggggctccttcagcgatgat
ggggcgctgggaccagtgctgaccaccttcgaccataccctggaccatgagtccctgaat
cctggtgctcagaggtttgagaagatgatcggaggcctgtacctgggtgagctggtgcgg
ctggtgctggctcacttggcccggtgtggggtcctctttggtggctgcacctcccctgcc
ctgctgagccaaggcagcatcctcctggaacacgtggctgagatggaggacccctctact
ggggcagcccgtgtccatgctatcctgcaggacttgggcctgagccctggggcttcggat
gttgagcttgtgcagcacgtctgtgcggccgtgtgcacgcgggctgcccagctctgtgct
gccgccctggccgctgttctctcctgcctccagcacagccgggagcaacaaacactccag
gttgctgtggccaccggaggccgagtgtgtgagcggcaccccaggttctgcagcgtcctg
caggggacagtgatgctcctggccccggaatgcgatgtctccttaatcccctctgtggat
ggtggtggccggggagtggcgatggtgactgccgtggctgcccgtctggctgcccaccgg
cgcctgctggaggagaccctggccccattccggttgaaccatgatcaactggctgcggtt
caggcacagatgcggaaggccatggccaaggggctccgaggggaggcctcctcccttcgc
atgctgcccactttcgtccgggccacccctgacggcagcgagcgaggggatttcctggcc
ctggacctcgggggcacgaacttccgtgtcctcctggtacgtgtgaccacaggcgtgcag
atcaccagcgagatctactccattcccgagactgtggcccagggttctgggcagcagctc
tttgaccacatcgtggactgcatcgtggacttccagcagaagcagggcctgagcgggcag
agcctcccactgggttttaccttctccttcccatgtaggcagcttggcctagaccagggc
atcctcctgaactggaccaagggtttcaaggcatcagactgcgagggccaagatgtcgtg
agtctgttgcgggaagccatcactcgcagacaggcagtggagctgaatgtggttgccatt
gtcaatgacacggtggggaccatgatgtcctgtggctatgaggacccccgttgcgagata
ggcctcattgtcggaaccggcaccaatgcctgctacatggaggagctccggaatgtggcg
ggcgtgcctggggactcaggccgcatgtgcatcaacatggagtggggcgcctttggggac
gatggctctctggccatgctcagcacccgctttgatgcaagtgtggaccaggcgtccatc
aaccccggcaagcagaggtttgaaaagatgatcagcggcatgtacctgggggagatcgtc
cgccacatccttttacatttaaccagccttggcgttctcttccggggccagcagatccag
cgccttcagaccagggacatcttcaagaccaagttcctctctgagatcgaaagtgacagc
ctggccctgcggcaggtccgagccatcctagaggatctggggctacccctgacctcagat
gacgccctgatggtgctagaggtgtgccaggctgtgtcccagagggctgcccagctctgt
ggggcgggtgtagctgccgtggtggagaagatccgggagaaccggggcctggaagagctg
gcagtgtctgtgggggtggatggaacgctctacaagctgcacccgcgcttctccagcctg
gtggcggccacagtgcgggagctggcccctcgctgtgtggtcacgttcctgcagtcagag
gatgggtccggcaaaggtgcggccctggtcaccgctgttgcctgccgccttgcgcagttg
actcgtgtctga

Protein sequence

>3101 : length: 923
MDSIGSSGLRQGEETLSCSEEGLPGPSDSSELVQECLQQFKVTRAQLQQIQASLLGSMEQ
ALRGQASPAPAVRMLPTYVGSTPHGTEQGDFVVLELGATGASLRVLWVTLTGIEGHRVEP
RSQEFVIPQEVMLGAGQQLFDFAAHCLSEFLDAQPVNKQGLQLGFSFSFPCHQTGLDRST
LISWTKGFRCSGVEGQDVVQLLRDAIRRQGAYNIDVVAVVNDTVGTMMGCEPGVRPCEVG
LVVDTGTNACYMEEARHVAVLDEDRGRVCVSVEWGSFSDDGALGPVLTTFDHTLDHESLN
PGAQRFEKMIGGLYLGELVRLVLAHLARCGVLFGGCTSPALLSQGSILLEHVAEMEDPST
GAARVHAILQDLGLSPGASDVELVQHVCAAVCTRAAQLCAAALAAVLSCLQHSREQQTLQ
VAVATGGRVCERHPRFCSVLQGTVMLLAPECDVSLIPSVDGGGRGVAMVTAVAARLAAHR
RLLEETLAPFRLNHDQLAAVQAQMRKAMAKGLRGEASSLRMLPTFVRATPDGSERGDFLA
LDLGGTNFRVLLVRVTTGVQITSEIYSIPETVAQGSGQQLFDHIVDCIVDFQQKQGLSGQ
SLPLGFTFSFPCRQLGLDQGILLNWTKGFKASDCEGQDVVSLLREAITRRQAVELNVVAI
VNDTVGTMMSCGYEDPRCEIGLIVGTGTNACYMEELRNVAGVPGDSGRMCINMEWGAFGD
DGSLAMLSTRFDASVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSLGVLFRGQQIQ
RLQTRDIFKTKFLSEIESDSLALRQVRAILEDLGLPLTSDDALMVLEVCQAVSQRAAQLC
GAGVAAVVEKIRENRGLEELAVSVGVDGTLYKLHPRFSSLVAATVRELAPRCVVTFLQSE
DGSGKGAALVTAVACRLAQLTRV



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min