Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

3157, HMGCS1

Enzyme Number

2.3.3.10

RLRdb entry

RL00047

Organisms

Human (9606)

Synonyms

HMGCS|MGC90332;
HMGCS1;
3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 (soluble);
hydroxymethylglutaryl-CoA synthase 1

Description

3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 (soluble)

Xrefs

HGNC:5007| MIM:142940| Ensembl:ENSG00000112972| HPRD:07515

Chromosome

5 : 5p14-p13

Links to iHOP

3157

Sequence Information

Nucleotide sequence

>3157 : length: 1563
atgcctggatcacttcctttgaatgcagaagcttgctggccaaaagatgtgggaattgtt
gcccttgagatctattttccttctcaatatgttgatcaagcagagttggaaaaatatgat
ggtgtagatgctggaaagtataccattggcttgggccaggccaagatgggcttctgcaca
gatagagaagatattaactctctttgcatgactgtggttcagaatcttatggagagaaat
aacctttcctatgattgcattgggcggctggaagttggaacagagacaatcatcgacaaa
tcaaagtctgtgaagactaatttgatgcagctgtttgaagagtctgggaatacagatata
gaaggaatcgacacaactaatgcatgctatggaggcacagctgctgtcttcaatgctgtt
aactggattgagtccagctcttgggatggacggtatgccctggtagttgcaggagatatt
gctgtatatgccacaggaaatgctagacctacaggtggagttggagcagtagctctgcta
attgggccaaatgctcctttaatttttgaacgagggcttcgtgggacacatatgcaacat
gcctatgatttttacaagcctgatatgctatctgaatatcctatagtagatggaaaactc
tccatacagtgctacctcagtgcattagaccgctgctattctgtctactgcaaaaagatc
catgcccagtggcagaaagagggaaatgataaagattttaccttgaatgattttggcttc
atgatctttcactcaccatattgtaaactggttcagaaatctctagctcggatgttgctg
aatgacttccttaatgaccagaatagagataaaaatagtatctatagtggcctggaagcc
tttggggatgttaaattagaagacacctactttgatagagatgtggagaaggcatttatg
aaggctagctctgaactcttcagtcagaaaacaaaggcatctttacttgtatcaaatcaa
aatggaaatatgtacacatcttcagtatatggttcccttgcatctgttctagcacagtac
tcacctcagcaattagcagggaagagaattggagtgttttcttatggttctggtttggct
gccactctgtactctcttaaagtcacacaagatgctacaccggggtctgctcttgataaa
ataacagcaagtttatgtgatcttaaatcaaggcttgattcaagaactggtgtggcacca
gatgtcttcgctgaaaacatgaagctcagagaggacacccatcatttggtcaactatatt
ccccagggttcaatagattcactctttgaaggaacgtggtacttagttagggtggatgaa
aagcacagaagaacttacgctcggcgtcccactccaaatgatgacactttggatgaagga
gtaggacttgtgcattcaaacatagcaactgagcatattccaagccctgccaagaaagta
ccaagactccctgccacagcagcagaacctgaagcagctgtcattagtaatggggaacat
taa

Protein sequence

>3157 : length: 520
MPGSLPLNAEACWPKDVGIVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQAKMGFCT
DREDINSLCMTVVQNLMERNNLSYDCIGRLEVGTETIIDKSKSVKTNLMQLFEESGNTDI
EGIDTTNACYGGTAAVFNAVNWIESSSWDGRYALVVAGDIAVYATGNARPTGGVGAVALL
IGPNAPLIFERGLRGTHMQHAYDFYKPDMLSEYPIVDGKLSIQCYLSALDRCYSVYCKKI
HAQWQKEGNDKDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA
FGDVKLEDTYFDRDVEKAFMKASSELFSQKTKASLLVSNQNGNMYTSSVYGSLASVLAQY
SPQQLAGKRIGVFSYGSGLAATLYSLKVTQDATPGSALDKITASLCDLKSRLDSRTGVAP
DVFAENMKLREDTHHLVNYIPQGSIDSLFEGTWYLVRVDEKHRRTYARRPTPNDDTLDEG
VGLVHSNIATEHIPSPAKKVPRLPATAAEPEAAVISNGEH



Basic Information

Gene ID

3158, HMGCS2

Enzyme Number

2.3.3.10

RLRdb entry

RL00047

Organisms

Human (9606)

Synonyms

HMGCS2;
3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial);
OTTHUMP00000013928|hydroxymethylglutaryl-CoA synthase 2

Description

3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial)

Xrefs

HGNC:5008| MIM:600234| Ensembl:ENSG00000134240| HPRD:02580

Chromosome

1 : 1p13-p12

Links to iHOP

3158

Sequence Information

Nucleotide sequence

>3158 : length: 1527
atgcagcgtctgttgactccagtgaagcgcattctgcaactgacaagagcggtgcaggaa
acctccctcacacctgctcgcctgctcccagtagcccaccaaaggttttctacagcctct
gctgtccccctggccaaaacagatacttggccaaaggacgtgggcatcctggccctggag
gtctacttcccagcccaatatgtggaccaaactgacctggagaagtataacaatgtggaa
gcaggaaagtatacagtgggcttgggccagacccgtatgggcttctgctcagtccaagag
gacatcaactccctgtgcctgacggtggtgcaacggctgatggagcgcatacagctccca
tgggactctgtgggcaggctggaagtaggcactgagaccatcattgacaagtccaaagct
gtcaaaacagtgctcatggaactcttccaggattcaggcaatactgatattgagggcata
gataccaccaatgcctgctacggtggtactgcctccctcttcaatgctgccaactggatg
gagtccagttcctgggatggtcgttatgccatggtggtctgtggagacattgccgtctat
cccagtggtaatgctcgtcccacaggtggggccggagctgtggctatgctgattgggccc
aaggcccctctggccctggagcgagggctgaggggaacccatatggagaatgtgtatgac
ttctacaaaccaaatttggcctcggagtacccaatagtggatgggaagctttccatccag
tgctacttgcgggccttggatcgatgttacacatcataccgtaaaaaaatccagaatcag
tggaagcaagctggcagcgatcgacccttcacccttgacgatttacagtacatgatcttt
catacacccttttgcaagatggtccagaagtctctggctcgcctgatgttcaatgacttc
ctgtcagccagcagtgacacacaaaccagcttatataaggggctggaggctttcgggggg
ctaaagctggaagacacctacaccaacaaggacctggataaagcacttctaaaggcctct
caggacatgttcgacaagaaaaccaaggcttccctttacctctccactcacaatgggaac
atgtacacctcatccctgtacgggtgcctggcctcgcttctgtcccaccactctgcccaa
gaactggctggctccaggattggtgccttctcttatggctctggtttagcagcaagtttc
ttttcatttcgagtatcccaggatgctgctccaggctctcccctggacaagttggtgtcc
agcacatcagacctgccaaaacgcctagcctcccgaaagtgtgtgtctcctgaggagttc
acagaaataatgaaccaaagagagcaattctaccataaggtgaatttctccccacctggt
gacacaaacagccttttcccaggtacttggtacctggagcgagtggacgagcagcatcgc
cgaaagtatgcccggcgtcccgtctaa

Protein sequence

>3158 : length: 508
MQRLLTPVKRILQLTRAVQETSLTPARLLPVAHQRFSTASAVPLAKTDTWPKDVGILALE
VYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQEDINSLCLTVVQRLMERIQLP
WDSVGRLEVGTETIIDKSKAVKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANWM
ESSSWDGRYAMVVCGDIAVYPSGNARPTGGAGAVAMLIGPKAPLALERGLRGTHMENVYD
FYKPNLASEYPIVDGKLSIQCYLRALDRCYTSYRKKIQNQWKQAGSDRPFTLDDLQYMIF
HTPFCKMVQKSLARLMFNDFLSASSDTQTSLYKGLEAFGGLKLEDTYTNKDLDKALLKAS
QDMFDKKTKASLYLSTHNGNMYTSSLYGCLASLLSHHSAQELAGSRIGAFSYGSGLAASF
FSFRVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPG
DTNSLFPGTWYLERVDEQHRRKYARRPV



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min