Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

3283, HSD3B1

Enzyme Number

1.1.1.145

RLRdb entry

RL00033

RLRdb entry

RL00069

Organisms

Human (9606)

Synonyms

HSD3B|HSDB3;
HSD3B1;
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1;
hydroxy-delta-5-steroid dehydrogenase, 3 beta-and steroid delta-isomerase 1

Description

hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1

Xrefs

HGNC:5217| MIM:109715| Ensembl:ENSG00000203857| HPRD:04920

Chromosome

1 : 1p13.1

Links to iHOP

3283

Sequence Information

Nucleotide sequence

>3283 : length: 1122
atgacgggctggagctgccttgtgacaggagcaggagggtttctgggacagaggatcatc
cgcctcttggtgaaggagaaggagctgaaggagatcagggtcttggacaaggccttcgga
ccagaattgagagaggaattttctaaactccagaacaagaccaagctgacagtgctggaa
ggagacattctggatgagccattcctgaagagagcctgccaggacgtctcggtcatcatc
cacaccgcctgtatcattgatgtcttcggtgtcactcacagagagtctatcatgaatgtc
aatgtgaaaggtacccagctcctgttagaggcctgtgtccaagctagtgtgccagtcttc
atctacaccagtagcatagaggtagccgggcccaactcctacaaggaaatcatccagaat
ggccatgaagaagagcctctggaaaacacatggcccgctccatacccacacagcaaaaag
cttgctgagaaggctgtactggcggctaacgggtggaatctgaaaaacggcggcaccctg
tacacttgtgccttacgacccatgtatatctatggggaaggaagccgattcctttctgct
agtataaacgaggccctgaacaacaatgggatcctgtcaagtgttggaaagttctccact
gttaacccagtctatgttggcaatgtggcctgggcccacattctggccttgagggccctg
caggaccccaagaaggccccaagcatccgaggacagttctactatatctcagatgacacg
cctcaccaaagctatgataaccttaattacaccctgagcaaagagttcggcctccgcctt
gattccagatggagctttcctttatccctgatgtattggattggcttcctgctggaaata
gtgagcttcctactcaggccaatttacacctatcgaccgcccttcaaccgccacatagtc
acattgtcaaatagcgtattcaccttctcttataagaaggctcagcgagatctggcgtat
aagccactctacagctgggaggaagccaagcagaaaacggtggagtgggttggttccctt
gtggaccggcacaaggagaccctgaagtccaagactcagtga

Protein sequence

>3283 : length: 373
MTGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLE
GDILDEPFLKRACQDVSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVF
IYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTL
YTCALRPMYIYGEGSRFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRAL
QDPKKAPSIRGQFYYISDDTPHQSYDNLNYTLSKEFGLRLDSRWSFPLSLMYWIGFLLEI
VSFLLRPIYTYRPPFNRHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSL
VDRHKETLKSKTQ



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min