Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

35, ACADS

Enzyme Number

1.3.99.2

RLRdb entry

RL00073

Organisms

Human (9606)

Synonyms

ACAD3|SCAD;
ACADS;
acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain;
butyryl-CoA dehydrogenase|short chain acyl-CoA dehydrogenase|unsaturated acyl-CoA reductase

Description

acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain

Xrefs

HGNC:90| MIM:606885| Ensembl:ENSG00000122971| HPRD:06053

Chromosome

12 : 12q22-qter

Links to iHOP

35

Sequence Information

Nucleotide sequence

>35 : length: 1239
atggccgccgcgctgctcgcccgggcctcgggccctgcccgcagagctctctgtcctagg
gcctggcggcagttacacaccatctaccagtctgtggaactgcccgagacacaccagatg
ttgctccagacatgccgggactttgccgagaaggagttgtttcccattgcagcccaggtg
gataaggaacatctcttcccagcggctcaggtgaagaagatgggcgggcttgggcttctg
gccatggacgtgcccgaggagcttggcggtgctggcctcgattacctggcctacgccatc
gccatggaggagatcagccgtggctgcgcctccaccggagtcatcatgagtgtcaacaac
tctctctacctggggcccatcttgaagtttggctccaaggagcagaagcaggcgtgggtc
acgcctttcaccagtggtgacaaaattggctgctttgccctcagcgaaccagggaacggc
agtgatgcaggagctgcgtccaccaccgcccgggccgagggcgactcatgggttctgaat
ggaaccaaagcctggatcaccaatgcctgggaggcttcggctgccgtggtctttgccagc
acggacagagccctgcaaaacaagggcatcagtgccttcctggtccccatgccaacgcct
gggctcacgttggggaagaaagaagacaagctgggcatccggggctcatccacggccaac
ctcatctttgaggactgtcgcatccccaaggacagcatcctgggggagccagggatgggc
ttcaagatagccatgcaaaccctggacatgggccgcatcggcatcgcctcccaggccctg
ggcattgcccagaccgccctcgattgtgctgtgaactacgctgagaatcgcatggccttc
ggggcgcccctcaccaagctccaggtcatccagttcaagttggcagacatggccctggcc
ctggagagtgcccggctgctgacctggcgcgctgccatgctgaaggataacaagaagcct
ttcatcaaggaggcagccatggccaagctggccgcctcggaggccgcgaccgccatcagc
caccaggccatccagatcctgggcggcatgggctacgtgacagagatgccggcagagcgg
cactaccgcgacgcccgcatcactgagatctacgagggcaccagcgaaatccagcggctg
gtgatcgccgggcatctgctcaggagctaccggagctga

Protein sequence

>35 : length: 412
MAAALLARASGPARRALCPRAWRQLHTIYQSVELPETHQMLLQTCRDFAEKELFPIAAQV
DKEHLFPAAQVKKMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRGCASTGVIMSVNN
SLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLN
GTKAWITNAWEASAAVVFASTDRALQNKGISAFLVPMPTPGLTLGKKEDKLGIRGSSTAN
LIFEDCRIPKDSILGEPGMGFKIAMQTLDMGRIGIASQALGIAQTALDCAVNYAENRMAF
GAPLTKLQVIQFKLADMALALESARLLTWRAAMLKDNKKPFIKEAAMAKLAASEAATAIS
HQAIQILGGMGYVTEMPAERHYRDARITEIYEGTSEIQRLVIAGHLLRSYRS



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min