Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

361245, Cmah

Enzyme Number

1.14.18.2

RLRdb entry

RL00529

Organisms

Rat (10116)

Synonyms

Cmah;
cytidine monophosphate-N-acetylneuraminic acid hydroxylase (CMP-N-acetylneuraminate monooxygenase) pseudogene;
cytidine monophospho-N-acetylneuraminic acid hydroxylase

Description

cytidine monophosphate-N-acetylneuraminic acid hydroxylase (CMP-N-acetylneuraminate monooxygenase) pseudogene

Xrefs

RGD:1311930| Ensembl:ENSRNOG00000003094

Chromosome

17 : 17p11

Links to iHOP

361245

Sequence Information

Nucleotide sequence

>361245 : length: 1734
atgatggacaggaaacagacagccgagaccctgctgtccttgtctcctgctgacgtcgcc
aacctcaaggaaggagtcaatttttgtcgaaataagactactgggaaagagtacatttta
tacaaggagaaggaccacctaaaggcatgcaagaacctctgcaagcaccaaggtggcctg
ttcatgagagatatcgaggatttagatggaaggtccgttaaatgcacaaagcacaactgg
aagttagatgtgagcaccatgaagtataccaaccctccagggagcttctgtcaagacgag
cttgttgtggaaatggatgagaacaatgggctttgccttgtagaactgaaccctcctaac
ccctgggactctgaccccaggtctcctgaagaattagcttttggggaggtacagataaca
tatctcactcatgcctgcatggacctcaagttgggagacaagcggatggcgtttgaccct
tggttaattggtcctgcttttgccagaggatggtggttgctacacgagcctccatcggac
tggctggagagactgtgcaaagcagacctcatttacatcagccacatgcactcagaccac
ctgagttaccctaccctgaagcagctttcccagagacgaccagacatccccatttatgtt
ggtgacacagaaaggcctgtgttttggaatctgaatcatagcggtgtccaattaactaac
atcaacgtggttccatttggaatatggcaacaggtagacaaaaatcttcggttcatgatc
ttgatggacggcgttcatcctgagatggacacgtgcatcatcgtggagtacaaaggtcat
aaaatcctcaacacagtggactgcaccagacccaacgggggaaggctgcctgagaaagtt
gctctaatgatgagtgatttcgctggaggagcatcaggctttcccatgactttcagtggt
ggaaaatttactgaggaatggaaagcccagttcattaaggcagaaagaagaaaacttctg
aactacaaagctcagctggtgaaggatctgcagcctcgaatctactgcccatttgctggg
tactttgtggaagctcacccatctgacaagtatattaaggaaacaaacaccaaaaacgac
ccaaatcaactcaacaaccttatcaagaaaaactcgaatgtggtgacatggacccctcga
cctggagctacccttgacctgggcaggatgctgaaggacccaactgacagcaagggcatt
gtggaacctccggaaggaaccaaaatttacaaggattcctgggactttgagccatacctg
aagaccttgaattcttctgtcagagactcaatcttccttcactcatcctggattaaagaa
tacttcacttgggctggatttaagaattacaacctggtagtcaggatgattgaaacagat
gaagacttcagccctgtgcctggagggtacgactatctggtggactttctagatttatcc
tttccgaaagaaagacccagccgggagcatccttatgaagaaatccgcagccgtgtggat
gtcatcaggcacgtggtgaagaacggcctgctgtgggatgacctgtatattggatttcag
acccgattgcagcgggaccctgatatataccatcatctgttttggaatcattttcagata
aaactccctctaacaccacctaactggaagttgttcctaatgcgctgtggttag

Protein sequence

>361245 : length: 577
MMDRKQTAETLLSLSPADVANLKEGVNFCRNKTTGKEYILYKEKDHLKACKNLCKHQGGL
FMRDIEDLDGRSVKCTKHNWKLDVSTMKYTNPPGSFCQDELVVEMDENNGLCLVELNPPN
PWDSDPRSPEELAFGEVQITYLTHACMDLKLGDKRMAFDPWLIGPAFARGWWLLHEPPSD
WLERLCKADLIYISHMHSDHLSYPTLKQLSQRRPDIPIYVGDTERPVFWNLNHSGVQLTN
INVVPFGIWQQVDKNLRFMILMDGVHPEMDTCIIVEYKGHKILNTVDCTRPNGGRLPEKV
ALMMSDFAGGASGFPMTFSGGKFTEEWKAQFIKAERRKLLNYKAQLVKDLQPRIYCPFAG
YFVEAHPSDKYIKETNTKNDPNQLNNLIKKNSNVVTWTPRPGATLDLGRMLKDPTDSKGI
VEPPEGTKIYKDSWDFEPYLKTLNSSVRDSIFLHSSWIKEYFTWAGFKNYNLVVRMIETD
EDFSPVPGGYDYLVDFLDLSFPKERPSREHPYEEIRSRVDVIRHVVKNGLLWDDLYIGFQ
TRLQRDPDIYHHLFWNHFQIKLPLTPPNWKLFLMRCG



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min