Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

4023, LPL

Enzyme Number

3.1.1.34

RLRdb entry

RL00277

Organisms

Human (9606)

Synonyms

HDLCQ11|LIPD;
LPL;
lipoprotein lipase;
-

Description

lipoprotein lipase

Xrefs

HGNC:6677| MIM:609708| Ensembl:ENSG00000175445| HPRD:01999

Chromosome

8 : 8p22

Links to iHOP

4023

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

4023 84164 PMID: 16169070
4023 2010 PMID: 12755701
4023 7436 PMID: 7592875
4023 4036 PMID: 7686151
4023 4035 PMID: 7989348
4023 4035 PMID: 1281473|7510694
4023 4035 PMID: 7510694
4023 4035 PMID: 1281473
4023 5775 PMID: 16169070
4023 65264 PMID: 16169070
4023 6142 PMID: 16169070
4023 57562 PMID: 16169070
4023 10980 PMID: 16169070
4023 344 PMID: 10727238
4023 344 PMID: 11579204
4023 1071 PMID: 9374130
4023 51631 PMID: 16169070

Sequence Information

Nucleotide sequence

>4023 : length: 1428
atggagagcaaagccctgctcgtgctgactctggccgtgtggctccagagtctgaccgcc
tcccgcggaggggtggccgccgccgaccaaagaagagattttatcgacatcgaaagtaaa
tttgccctaaggacccctgaagacacagctgaggacacttgccacctcattcccggagta
gcagagtccgtggctacctgtcatttcaatcacagcagcaaaaccttcatggtgatccat
ggctggacggtaacaggaatgtatgagagttgggtgccaaaacttgtggccgccctgtac
aagagagaaccagactccaatgtcattgtggtggactggctgtcacgggctcaggagcat
tacccagtgtccgcgggctacaccaaactggtgggacaggatgtggcccggtttatcaac
tggatggaggaggagtttaactaccctctggacaatgtccatctcttgggatacagcctt
ggagcccatgctgctggcattgcaggaagtctgaccaataagaaagtcaacagaattact
ggcctcgatccagctggacctaactttgagtatgcagaagccccgagtcgtctttctcct
gatgatgcagattttgtagacgtcttacacacattcaccagagggtcccctggtcgaagc
attggaatccagaaaccagttgggcatgttgacatttacccgaatggaggtacttttcag
ccaggatgtaacattggagaagctatccgcgtgattgcagagagaggacttggagatgtg
gaccagctagtgaagtgctcccacgagcgctccattcatctcttcatcgactctctgttg
aatgaagaaaatccaagtaaggcctacaggtgcagttccaaggaagcctttgagaaaggg
ctctgcttgagttgtagaaagaaccgctgcaacaatctgggctatgagatcaataaagtc
agagccaaaagaagcagcaaaatgtacctgaagactcgttctcagatgccctacaaagtc
ttccattaccaagtaaagattcatttttctgggactgagagtgaaacccataccaatcag
gcctttgagatttctctgtatggcaccgtggccgagagtgagaacatcccattcactctg
cctgaagtttccacaaataagacctactccttcctaatttacacagaggtagatattgga
gaactactcatgttgaagctcaaatggaagagtgattcatactttagctggtcagactgg
tggagcagtcccggcttcgccattcagaagatcagagtaaaagcaggagagactcagaaa
aaggtgatcttctgttctagggagaaagtgtctcatttgcagaaaggaaaggcacctgcg
gtatttgtgaaatgccatgacaagtctctgaataagaagtcaggctga

Protein sequence

>4023 : length: 475
MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGV
AESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEH
YPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRIT
GLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ
PGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKG
LCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQ
AFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDW
WSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min