Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

4638, MYLK

Enzyme Number

2.7.11.18

RLRdb entry

RL00029

Organisms

Human (9606)

Synonyms

DKFZp686I10125|FLJ12216|KRP|MLCK|MLCK1|MLCK108|MLCK210|MSTP083|MYLK1|smMLCK;
MYLK;
myosin light chain kinase;
OTTHUMP00000180642|OTTHUMP00000180643|myosin, light polypeptide kinase|smooth muscle myosin light chain kinase

Description

myosin light chain kinase

Xrefs

HGNC:7590| MIM:600922| Ensembl:ENSG00000065534| HPRD:02952

Chromosome

3 : 3q21

Links to iHOP

4638

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

4638 5593 PMID: 6547441
4638 5058 PMID: 10092231
4638 2017 PMID: 12408982
4638 70 PMID: 12110694
4638 5578 PMID: 3160694
4638 6714 PMID: 10362724
4638 801 PMID: 7947686
4638 5595 PMID: 10402467

Sequence Information

Nucleotide sequence

>4638 : length: 5745
atgggggatgtgaagctggttgcctcgtcacacatttccaaaacctccctcagtgtggat
ccctcaagagttgactccatgcccctgacagaggcccctgctttcattttgccccctcgg
aacctctgcatcaaagaaggagccaccgccaagttcgaagggcgggtccggggttaccca
gagccccaggtgacatggcacagaaacgggcaacccatcaccagcgggggccgcttcctg
ctggattgcggcatccgggggactttcagccttgtgattcatgctgtccatgaggaggac
aggggaaagtatacctgtgaagccaccaatggcagtggtgctcgccaggtgacagtggag
ttgacagtagaaggaagttttgcgaagcagcttggtcagcctgttgtttccaaaacctta
ggggatagattttcagctccagcagtggagacccgtcctagcatctggggggagtgccca
ccaaagtttgctaccaagctgggccgagttgtggtcaaagaaggacagatgggacgattc
tcctgcaagatcactggccggccccaaccgcaggtcacctggctcaagggaaatgttcca
ctgcagccgagtgcccgtgtgtctgtgtctgagaagaacggcatgcaggttctggaaatc
catggagtcaaccaagatgacgtgggagtgtacacgtgcctggtggtgaacgggtcgggg
aaggcctcgatgtcagctgaactttccatccaaggtttggacagtgccaataggtcattt
gtgagagaaacaaaagccaccaattcagatgtcaggaaagaggtgaccaatgtaatctca
aaggagtcgaagctggacagtctggaggctgcagccaaaagcaagaactgctccagcccc
cagagaggtggctccccaccctgggctgcaaacagccagcctcagcccccaagggagtcc
aagctggagtcatgcaaggactcgcccagaacggccccgcagaccccggtccttcagaag
acttccagctccatcaccctgcaggccgcaagagttcagccggaaccaagagcaccaggc
ctgggggtcctatcaccttctggagaagagaggaagaggccagctcctccccgtccagcc
accttccccaccaggcagcctggcctggggagccaagatgttgtgagcaaggctgctaac
aggagaatccccatggagggccagagggattcagcattccccaaatttgagagcaagccc
caaagccaggaggtcaaggaaaatcaaactgtcaagttcagatgtgaagtttccgggatt
ccaaagcctgaagtggcctggttcctggaaggcacccccgtgaggagacaggaaggcagc
attgaggtttatgaagatgctggctcccattacctctgcctgctgaaagcccggaccagg
gacagtgggacatacagctgcactgcttccaacgcccaaggccagctgtcctgtagctgg
accctccaagtggaaaggcttgccgtgatggaggtggccccctccttctccagtgtcctg
aaggactgcgctgttattgagggccaggattttgtgctgcagtgctccgtacgggggacc
ccagtgccccggatcacttggctgctgaatgggcagcccatccagtacgctcgctccacc
tgcgaggccggcgtggctgagctccacatccaggatgccctgccggaggaccatggcacc
tacacctgcctagctgagaatgccttggggcaggtgtcctgcagcgcctgggtcaccgtc
catgaaaagaagagtagcaggaagagtgagtaccttctgcctgtggctcccagcaagccc
actgcacccatcttcctgcagggcctctctgatctcaaagtcatggatggaagccaggtc
actatgactgtccaagtgtcagggaatccaccccctgaagtcatctggctgcacaatggg
aatgagatccaagagtcagaggacttccactttgaacagagaggaactcagcacagcctt
tgtatccaggaagtgttcccggaggacacgggcacgtacacctgcgaggcctggaacagc
gctggagaggtccgcacccaggccgtgctcacggtacaagagcctcacgatggcacccag
ccctggttcatcagtaagcctcgctcagtgacagcctccctgggccagagtgtcctcatc
tcctgcgccatagctggtgacccctttcctaccgtgcactggctcagagatggcaaagcc
ctctgcaaagacactggccacttcgaggtgcttcagaatgaggacgtgttcaccctggtt
ctaaagaaggtgcagccctggcatgccggccagtatgagatcctgctcaagaaccgggtt
ggcgaatgcagttgccaggtgtcactgatgctacagaacagctctgccagagcccttcca
cgggggagggagcctgccagctgcgaggacctctgtggtggaggagttggtgctgatggt
ggtggtagtgaccgctatgggtccctgaggcctggctggccagcaagagggcagggttgg
ctagaggaggaagacggcgaggacgtgcgaggggtgctgaagaggcgcgtggagacgagg
cagcacactgaggaggcgatccgccagcaggaggtggagcagctggacttccgagacctc
ctggggaagaaggtgagtacaaagaccctatcggaagacgacctgaaggagatcccagcc
gagcagatggatttccgtgccaacctgcagcggcaagtgaagccaaagactgtgtctgag
gaagagaggaaggtgcacagcccccagcaggtcgattttcgctctgtcctggccaagaag
gggacttccaagacccccgtgcctgagaaggtgccaccgccaaaacctgccaccccggat
tttcgctcagtgctgggtggcaagaagaaattaccagcagagaatggcagcagcagtgcc
gagaccctgaatgccaaggcagtggagagttccaagcccctgagcaatgcacagccttca
gggcccttgaaacccgtgggcaacgccaagcctgctgagaccctgaagccaatgggcaac
gccaagcctgccgagaccctgaagcccatgggcaatgccaagcctgatgagaacctgaaa
tccgctagcaaagaagaactcaagaaagacgttaagaatgatgtgaactgcaagagaggc
catgcagggaccacagataatgaaaagagatcagagagccaggggacagccccagccttc
aagcagaagctgcaagatgttcatgtggcagagggcaagaagctgctgctccagtgccag
gtgtcttctgaccccccagccaccatcatctggacgctgaacggaaagaccctcaagacc
accaagttcatcatcctctcccaggaaggctcactctgctccgtctccatcgagaaggca
ctgcctgaggacagaggcttatacaagtgtgtagccaagaatgacgctggccaggcggag
tgctcctgccaagtcaccgtggatgatgctccagccagtgagaacaccaaggccccagag
atgaaatcccggaggcccaagagctctcttcctcccgtgctaggaactgagagtgatgcg
actgtgaaaaagaaacctgcccccaagacacctccgaaggcagcaatgccccctcagatc
atccagttccctgaggaccagaaggtacgcgcaggagagtcagtggagctgtttggcaaa
gtgacaggcactcagcccatcacctgtacctggatgaagttccgaaagcagatccaggaa
agcgagcacatgaaggtggagaacagcgagaatggcagcaagctcaccatcctggccgcg
cgccaggagcactgcggctgctacacactgctggtggagaacaagctgggcagcaggcag
gcccaggtcaacctcactgtcgtggataagccagaccccccagctggcacaccttgtgcc
tctgacattcggagctcctcactgaccctgtcctggtatggctcctcatatgatgggggc
agtgctgtacagtcctacagcatcgagatctgggactcagccaacaagacgtggaaggaa
ctagccacatgccgcagcacctctttcaacgtccaggacctgctgcctgaccacgaatat
aagttccgtgtacgtgcaatcaacgtgtatggaaccagtgagccaagccaggagtctgaa
ctcacaacggtaggagagaaacctgaagagccgaaggatgaagtggaggtgtcagatgat
gatgagaaggagcccgaggttgattaccggacagtgacaatcaatactgaacaaaaagta
tctgacttctacgacattgaggagagattaggatctgggaaatttggacaggtctttcga
cttgtagaaaagaaaactcgaaaagtctgggcagggaagttcttcaaggcatattcagca
aaagagaaagagaatatccggcaggagattagcatcatgaactgcctccaccaccctaag
ctggtccagtgtgtggatgcctttgaagaaaaggccaacatcgtcatggtcctggagatc
gtgtcaggaggggagctgtttgagcgcatcattgacgaggactttgagctgacggagcgt
gagtgcatcaagtacatgcggcagatctcggagggagtggagtacatccacaagcagggc
atcgtgcacctggacctcaagccggagaacatcatgtgtgtcaacaagacgggcaccagg
atcaagctcatcgactttggtctggccaggaggctggagaatgcggggtctctgaaggtc
ctctttggcaccccagaatttgtggctcctgaagtgatcaactatgagcccatcggctac
gccacagacatgtggagcatcggggtcatctgctacatcctagtcagtggcctttccccc
ttcatgggagacaacgataacgaaaccttggccaacgttacctcagccacctgggacttc
gacgacgaggcattcgatgagatctccgacgatgccaaggatttcatcagcaatctgctg
aagaaagatatgaaaaaccgcctggactgcacgcagtgccttcagcatccatggctaatg
aaagataccaagaacatggaggccaagaaactctccaaggaccggatgaagaagtacatg
gcaagaaggaaatggcagaaaacgggcaatgctgtgagagccattggaagactgtcctct
atggcaatgatctcagggctcagtggcaggaaatcctcaacagggtcaccaaccagcccg
ctcaatgcagaaaaactagaatctgaagaagatgtgtcccaagctttccttgaggctgtt
gctgaggaaaagcctcatgtaaaaccctatttctctaagaccattcgcgatttagaagtt
gtggagggaagtgctgctagatttgactgcaagattgaaggatacccagaccccgaggtt
gtctggttcaaagatgaccagtcaatcagggagtcccgccacttccagatagactacgat
gaggacgggaactgctctttaattattagtgatgtttgcggggatgacgatgccaagtac
acctgcaaggctgtcaacagtcttggagaagccacctgcacagcagagctcattgtggaa
acgatggaggaaggtgaaggggaaggggaagaggaagaagagtga

Protein sequence

>4638 : length: 1914
MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYP
EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE
LTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF
SCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSG
KASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSP
QRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPG
LGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKP
QSQEVKENQTVKFRCEVSGIPKPEVAWFLEGTPVRRQEGSIEVYEDAGSHYLCLLKARTR
DSGTYSCTASNAQGQLSCSWTLQVERLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGT
PVPRITWLLNGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTV
HEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNG
NEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQ
PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLV
LKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGVGADG
GGSDRYGSLRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDL
LGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKK
GTSKTPVPEKVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPS
GPLKPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRG
HAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKT
TKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPE
MKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGK
VTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQ
AQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE
LATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDD
DEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSA
KEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTER
ECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKV
LFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDF
DDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYM
ARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAV
AEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYD
EDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEEEE



Basic Information

Gene ID

85366, MYLK2

Enzyme Number

2.7.11.18

RLRdb entry

RL00029

Organisms

Human (9606)

Synonyms

KMLC|MLCK|MLCK2|skMLCK;
MYLK2;
myosin light chain kinase 2;
OTTHUMP00000030560|OTTHUMP00000030561|OTTHUMP00000030562|myosin light chain kinase 2, skeletal muscle|skeletal muscle myosin light chain kinase|skeletal myosin light chain kinase

Description

myosin light chain kinase 2

Xrefs

HGNC:16243| MIM:606566| Ensembl:ENSG00000101306| HPRD:05953

Chromosome

20 : 20q13.31

Links to iHOP

85366

Sequence Information

Nucleotide sequence

>85366 : length: 1791
atggcgacagaaaatggagcagttgagctgggaattcagaacccatcaacagacaaggca
cctaaaggtcccacaggtgaaagacccctggctgcagggaaagaccctggccccccagac
ccaaagaaagctccggatccacccaccctgaagaaagatgccaaagcccctgcctcagag
aaaggggatggtaccctggcccaaccctcaactagcagccaaggccccaaaggagagggt
gacaggggcggggggcccgcggagggcagtgctgggcccccggcagccctgccccagcag
actgcgacacctgagaccagcgtcaagaagcccaaggctgagcagggagcctcaggcagc
caggatcctggaaagcccagggtgggcaagaaggcagcagagggccaagcagcagccagg
aggggctcacctgcctttctgcatagccccagctgtcctgccatcatctccagttctgag
aagctgctggccaagaagcccccaagcgaggcatcagagctcacctttgaaggggtgccc
atgacccacagccccacggatcccaggccagccaaggcagaagaaggaaagaacatcctg
gcagagagccagaaggaagtgggagagaaaaccccaggccaggctggccaggctaagatg
caaggggacacctcgagggggattgagttccaggctgttccctcagagaaatccgaggtg
gggcaggccctctgtctcacagccagggaggaggactgcttccagattttggatgattgc
ccgccacctccggcccccttccctcaccgcatggtggagctgaggaccgggaatgtcagc
agtgaattcagtatgaactccaaggaggcgctcggaggtggcaagtttggggcagtctgt
acctgcatggagaaagccacaggcctcaagctggcagccaaggtcatcaagaaacagact
cccaaagacaaggaaatggtgttgctggagattgaggtcatgaaccagctgaaccaccgc
aatctgatccagctgtatgcagccatcgagactccgcatgagatcgtcctgttcatggag
tacatcgagggcggagagctcttcgagaggattgtggatgaggactaccatctgaccgag
gtggacaccatggtgtttgtcaggcagatctgtgacgggatcctcttcatgcacaagatg
agggttttgcacctggacctcaagccagagaacatcctgtgtgtcaacaccaccgggcat
ttggtgaagatcattgactttggcctggcacggaggtataaccccaacgagaagctgaag
gtgaactttgggaccccagagttcctgtcacctgaggtggtgaattatgaccaaatctcc
gataagacagacatgtggagtatgggggtgatcacctacatgctgctgagcggcctctcc
cccttcctgggagatgatgacacagagaccctaaacaacgttctatctggcaactggtac
tttgatgaagagacctttgaggccgtatcagacgaggccaaagactttgtctccaacctc
atcgtcaaggaccagagggcccggatgaacgctgcccagtgtctcgcccatccctggctc
aacaacctggcggagaaagccaaacgctgtaaccgacgccttaagtcccagatcttgctt
aagaaatacctcatgaagaggcgctggaagaaaaacttcattgctgtcagcgctgccaac
cgcttcaagaagatcagcagctcgggggcactgatggctctgggggtctga

Protein sequence

>85366 : length: 596
MATENGAVELGIQNPSTDKAPKGPTGERPLAAGKDPGPPDPKKAPDPPTLKKDAKAPASE
KGDGTLAQPSTSSQGPKGEGDRGGGPAEGSAGPPAALPQQTATPETSVKKPKAEQGASGS
QDPGKPRVGKKAAEGQAAARRGSPAFLHSPSCPAIISSSEKLLAKKPPSEASELTFEGVP
MTHSPTDPRPAKAEEGKNILAESQKEVGEKTPGQAGQAKMQGDTSRGIEFQAVPSEKSEV
GQALCLTAREEDCFQILDDCPPPPAPFPHRMVELRTGNVSSEFSMNSKEALGGGKFGAVC
TCMEKATGLKLAAKVIKKQTPKDKEMVLLEIEVMNQLNHRNLIQLYAAIETPHEIVLFME
YIEGGELFERIVDEDYHLTEVDTMVFVRQICDGILFMHKMRVLHLDLKPENILCVNTTGH
LVKIIDFGLARRYNPNEKLKVNFGTPEFLSPEVVNYDQISDKTDMWSMGVITYMLLSGLS
PFLGDDDTETLNNVLSGNWYFDEETFEAVSDEAKDFVSNLIVKDQRARMNAAQCLAHPWL
NNLAEKAKRCNRRLKSQILLKKYLMKRRWKKNFIAVSAANRFKKISSSGALMALGV



Basic Information

Gene ID

91807, MYLK3

Enzyme Number

2.7.11.18

RLRdb entry

RL00029

Organisms

Human (9606)

Synonyms

MGC126319|MGC126320|MLCK|MLCK2|caMLCK;
MYLK3;
myosin light chain kinase 3;
MLC kinase|cardiac-MyBP-C associated Ca/CaM kinase

Description

myosin light chain kinase 3

Xrefs

HGNC:29826| MIM:612147| Ensembl:ENSG00000140795| HPRD:11281

Chromosome

16 : 16q11.2

Links to iHOP

91807

Sequence Information

Nucleotide sequence

>91807 : length: 2460
atgtcaggaacctccaaggagagtctggggcatggggggctgccagggttgggcaagacc
tgcttaacaaccatggacacaaagctgaacatgctgaacgagaaggtggaccagctcctg
cacttccaagaagatgtcacagagaagttgcagagcatgtgccgagacatgggccacctg
gagcggggcctgcacaggctggaggcctcccgggcaccgggcccgggcggggctgatggg
gttccccacattgacacccaggctgggtggcccgaggtcctggagctggtgagggccatg
cagcaggatgcggcccagcacggtgccaggctggaggccctcttcaggatggtggctgcg
gtggacagggccatcgctttggtgggggccacgttccagaaatcaaaggtggcggatttc
ctcatgcaggggcgtgtgccctggaggagaggcagcccaggtgacagccctgaggagaat
aaagagcgagtggaagaagagggaggaaaaccaaagcatgtgctgagcaccagtggggtg
cagtctgatgccagggagcctggggaagagagccagaaggcggacgtgctggaggggaca
gcggagaggctgccccccatcagagcgtcagggctgggagctgaccccgcccaggcagtg
gtctcaccgggccagggagatggtgttcctggcccagcccaggcattccctggccacctg
cccctgcccacaaaggtggaagccaaggctcctgagacacccagcgagaacctcaggact
ggcctggaattggctccagcacccggcagggtcaatgtggtctccccgagcctggaggtt
gcaccaggtgcaggacaaggagcatcgtccagcaggcctgaccctgagcccttagaggaa
ggcacgaggctgactccagggcctggccctcagtgcccagggcctccagggctgccagcc
caggccagggcaacccacagtggtggagaaacacctccaaggatctccatccacatacaa
gagatggatactcctggggagatgctgatgacaggcaggggcagccttggacccaccctc
accacagaggctccagcagctgcccagccaggcaagcagggcccacctgggaccgggcgc
tgcctccaagcccctgggactgagcccggagaacagacccctgaaggagccagagagctc
tccccgctgcaggagagcagcagccccgggggagtgaaggcagaggaggagcaaagggct
ggggccgagcctggcacgagaccaagcttggccaggagtgacgacaatgaccacgaggtt
ggggccctgggcctgcagcagggcaaaagcccaggggcgggaaaccctgagcctgagcag
gactgtgcagccagggctccggtgagagctgaagcagtaaggaggatgcccccaggcgcc
gaggctggcagcgtggttctggatgacagtccggccccaccagctccttttgaacaccgg
gtagtgagcgtcaaggagacctccatctctgcgggttacgaggtgtgccagcacgaagtc
ttgggagggggtcggtttggccaggtccacaggtgcacagagaagtccacaggcctccca
ctggctgccaagatcatcaaagtgaagagcgccaaggaccgggaggacgtgaagaacgag
atcaacatcatgaaccagctcagccacgtgaacctgatccagctctatgacgccttcgag
agcaagcacagctgcacccttgtcatggagtacgtggacgggggtgagctcttcgaccgg
atcacagatgagaagtaccacctgactgagctggatgtggtcctgttcaccaggcagatc
tgtgagggtgtgcattacctgcaccagcactacatcctgcacctggacctcaagccggag
aacatattgtgcgtcaatcagacaggacatcaaattaagatcattgactttgggctggcc
agaaggtacaagcctcgagagaagctgaaggtgaacttcggcactcctgagttcctggcc
ccagaagtcgtcaattatgagtttgtctcattccccacagacatgtggagtgtgggagtc
atcacctacatgctactcagtggcttgtccccatttctaggggaaacagatgcagagacc
atgaatttcattgtaaactgtagctgggattttgatgctgacacctttgaagggctctcg
gaggaggccaaggactttgtttcccggttgctggtcaaagagaagagctgcagaatgagt
gccacacagtgcctgaaacacgagtggctgaataatttgcctgccaaagcttcaagatcc
aaaactcgtctcaaatcccaactactgctgcagaaatacatagctcaaagaaaatggaag
aaacatttctatgtggtgactgctgccaacaggttaaggaaatttccaacttctccctaa

Protein sequence

>91807 : length: 819
MSGTSKESLGHGGLPGLGKTCLTTMDTKLNMLNEKVDQLLHFQEDVTEKLQSMCRDMGHL
ERGLHRLEASRAPGPGGADGVPHIDTQAGWPEVLELVRAMQQDAAQHGARLEALFRMVAA
VDRAIALVGATFQKSKVADFLMQGRVPWRRGSPGDSPEENKERVEEEGGKPKHVLSTSGV
QSDAREPGEESQKADVLEGTAERLPPIRASGLGADPAQAVVSPGQGDGVPGPAQAFPGHL
PLPTKVEAKAPETPSENLRTGLELAPAPGRVNVVSPSLEVAPGAGQGASSSRPDPEPLEE
GTRLTPGPGPQCPGPPGLPAQARATHSGGETPPRISIHIQEMDTPGEMLMTGRGSLGPTL
TTEAPAAAQPGKQGPPGTGRCLQAPGTEPGEQTPEGARELSPLQESSSPGGVKAEEEQRA
GAEPGTRPSLARSDDNDHEVGALGLQQGKSPGAGNPEPEQDCAARAPVRAEAVRRMPPGA
EAGSVVLDDSPAPPAPFEHRVVSVKETSISAGYEVCQHEVLGGGRFGQVHRCTEKSTGLP
LAAKIIKVKSAKDREDVKNEINIMNQLSHVNLIQLYDAFESKHSCTLVMEYVDGGELFDR
ITDEKYHLTELDVVLFTRQICEGVHYLHQHYILHLDLKPENILCVNQTGHQIKIIDFGLA
RRYKPREKLKVNFGTPEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPFLGETDAET
MNFIVNCSWDFDADTFEGLSEEAKDFVSRLLVKEKSCRMSATQCLKHEWLNNLPAKASRS
KTRLKSQLLLQKYIAQRKWKKHFYVVTAANRLRKFPTSP



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min