Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

5160, PDHA1

Enzyme Number

1.2.4.1

RLRdb entry

RL00002

RLRdb entry

RL00180

Organisms

Human (9606)

Synonyms

RP11-723P2.1;
PDHA|PDHCE1A|PHE1A;
PDHA1;
pyruvate dehydrogenase (lipoamide) alpha 1;
OTTHUMP00000023015|pyruvate dehydrogenase E1 alpha subunit

Description

pyruvate dehydrogenase (lipoamide) alpha 1

Xrefs

HGNC:8806| MIM:300502| Ensembl:ENSG00000131828| HPRD:02420

Chromosome

X : Xp22.2-p22.1

Links to iHOP

5160

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

5160 5160 PMID: 16189514
5160 3692 PMID: 16169070
5160 5165 PMID: 15861126
5160 5162 PMID: 16189514
5160 5162 PMID: 7864652
5160 8526 PMID: 17353931
5160 1737 PMID: 16189514
5160 1737 PMID: 14638692

Sequence Information

Nucleotide sequence

>5160 : length: 1173
atgaggaagatgctcgccgccgtctcccgcgtgctgtctggcgcttctcagaagccggca
agcagagtgctggtagcatcccgtaattttgcaaatgatgctacatttgaaattaagaaa
tgtgaccttcaccggctggaagaaggccctcctgtcacaacagtgctcaccagggaggat
gggctcaaatactacaggatgatgcagactgtacgccgaatggagttgaaagcagatcag
ctgtataaacagaaaattattcgtggtttctgtcacttgtgtgatggtcaggaagcttgc
tgtgtgggcctggaggccggcatcaaccccacagaccatctcatcacagcctaccgggct
cacggctttactttcacccggggcctttccgtccgagaaattctcgcagagcttacagga
cgaaaaggaggttgtgctaaagggaaaggaggatcgatgcacatgtatgccaagaacttc
tacgggggcaatggcatcgtgggagcgcaggtgcccctgggcgctgggattgctctagcc
tgtaagtataatggaaaagatgaggtctgcctgactttatatggcgatggtgctgctaac
cagggccagatattcgaagcttacaacatggcagctttgtggaaattaccttgtattttc
atctgtgagaataatcgctatggaatgggaacgtctgttgagagagcggcagccagcact
gattactacaagagaggcgatttcattcctgggctgagagtggatggaatggatatcctg
tgcgtccgagaggcaacaaggtttgctgctgcctattgtagatctgggaaggggcccatc
ctgatggagctgcagacttaccgttaccacggacacagtatgagtgaccctggagtcagt
taccgtacacgagaagaaattcaggaagtaagaagtaagagtgaccctattatgcttctc
aaggacaggatggtgaacagcaatcttgccagtgtggaagaactaaaggaaattgatgtg
gaagtgaggaaggagattgaggatgctgcccagtttgccacggccgatcctgagccacct
ttggaagagctgggctaccacatctactccagcgacccaccttttgaagttcgtggtgcc
aatcagtggatcaagtttaagtcagtcagttaa

Protein sequence

>5160 : length: 390
MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGPPVTTVLTRED
GLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRA
HGFTFTRGLSVREILAELTGRKGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALA
CKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAAST
DYYKRGDFIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVS
YRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPP
LEELGYHIYSSDPPFEVRGANQWIKFKSVS



Basic Information

Gene ID

5161, PDHA2

Enzyme Number

1.2.4.1

RLRdb entry

RL00002

RLRdb entry

RL00180

Organisms

Human (9606)

Synonyms

MGC149517|MGC149518|PDHAL;
PDHA2;
pyruvate dehydrogenase (lipoamide) alpha 2;
pyruvate dehydrogenase, E1-alpha polypeptide, testis specific

Description

pyruvate dehydrogenase (lipoamide) alpha 2

Xrefs

HGNC:8807| MIM:179061| Ensembl:ENSG00000163114| HPRD:01531

Chromosome

4 : 4q22-q23

Links to iHOP

5161

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

5161 5162 PMID: 7864652

Sequence Information

Nucleotide sequence

>5161 : length: 1167
atgctggccgccttcatctcccgcgtgttgaggcgagttgcccagaaatcagctcgcaga
gtgctggtggcatcccgtaactcctcaaatgacgctacatttgaaattaagaaatgtgat
ctttatctgttggaagagggtccccctgtcactacagtgctcactagggcggaggggctt
aaatactacaggatgatgctgactgttcgccgcatggaattgaaggcagatcagctgtac
aaacagaaattcattcgcggtttctgtcacctgtgcgatggtcaggaagcttgttgcgtg
ggccttgaggccggcataaacccctcggatcacgtcattacatcctatagggctcatggt
gtgtgctatactcggggactttctgtccgatccattctcgcagagctgacgggaagaaga
ggaggttgtgctaaaggaaaaggaggatcgatgcatatgtataccaagaacttctatggg
ggcaatggcatcgtcggtgcacagggccccctgggcgctggcattgctctggcctgtaaa
tataaaggaaacgatgagatctgtttgactttatatggggatggcgctgcgaatcagggg
cagatagccgaagctttcaatatggcagctttatggaaattaccttgtgttttcatctgt
gagaataacctatatggaatgggaacatctactgagagagcagcagccagccctgattac
tacaagaggggcaattttatccctgggctaaaggtcgatggaatggatgttctgtgtgtt
cgtgaggcaacaaaatttgcagctaactactgtagatctggaaaggggcccatactgatg
gagctgcaaacctaccgttatcatggacacagtatgagtgatcctggagtcagttatcgt
acacgagaagaaattcaggaagtaagaagtaagagggatcctataataattctccaagat
agaatggtaaacagcaagctcgccactgtggaagaattaaaggaaattggggctgaggtg
aggaaagaaattgatgatgctgcccagtttgctaccactgatcctgagccacatttggaa
gaattaggccatcacatctacagcagtgattcatcttttgaagttcgtggtgcaaatcca
tggatcaagtttaagtccgtcagttaa

Protein sequence

>5161 : length: 388
MLAAFISRVLRRVAQKSARRVLVASRNSSNDATFEIKKCDLYLLEEGPPVTTVLTRAEGL
KYYRMMLTVRRMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG
VCYTRGLSVRSILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVGAQGPLGAGIALACK
YKGNDEICLTLYGDGAANQGQIAEAFNMAALWKLPCVFICENNLYGMGTSTERAAASPDY
YKRGNFIPGLKVDGMDVLCVREATKFAANYCRSGKGPILMELQTYRYHGHSMSDPGVSYR
TREEIQEVRSKRDPIIILQDRMVNSKLATVEELKEIGAEVRKEIDDAAQFATTDPEPHLE
ELGHHIYSSDSSFEVRGANPWIKFKSVS



Basic Information

Gene ID

5162, PDHB

Enzyme Number

1.2.4.1

RLRdb entry

RL00002

RLRdb entry

RL00180

Organisms

Human (9606)

Synonyms

DKFZp564K0164|PHE1B;
PDHB;
pyruvate dehydrogenase (lipoamide) beta;
Pyruvate dehydrogenase, E1 beta polypeptide

Description

pyruvate dehydrogenase (lipoamide) beta

Xrefs

HGNC:8808| MIM:179060| Ensembl:ENSG00000168291| HPRD:01530

Chromosome

3 : 3p21.1-p14.2

Links to iHOP

5162

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

5162 5161 PMID: 7864652
5162 5160 PMID: 16189514
5162 5160 PMID: 7864652
5162 8050 PMID: 16189514
5162 8050 PMID: 7864652
5162 5162 PMID: 16189514
5162 1737 PMID: 16189514
5162 1737 PMID: 14638692

Sequence Information

Nucleotide sequence

>5162 : length: 1080
atggcggcggtgtctggcttggtgcggagaccccttcgggaggtctccgggctgctgaag
aggcgctttcactggaccgcgccggctgcgctgcaggtgacagttcgtgatgctataaat
cagggtatggatgaggagctggaaagagatgagaaggtatttctgcttggagaagaagtt
gcccagtatgatggggcatacaaggttagtcgagggctgtggaagaaatatggagacaag
aggattattgacactcccatatcagagatgggctttgctggaattgctgtaggtgcagct
atggctgggttgcggcccatttgtgaatttatgaccttcaatttctccatgcaagccatt
gaccaggttataaactcagctgccaagacctactacatgtctggtggccttcagcctgtg
cctatagtcttcagagggcccaatggtgcctcagcaggtgtagctgcccagcactcacag
tgctttgctgcctggtatgggcactgcccaggcttaaaggtggtcagtccctggaattca
gaggatgctaaaggacttattaaatcagccattcgggataacaatccagtggtggtgcta
gagaatgaattgatgtatggggttccttttgaatttcctccggaagctcagtcaaaagat
tttctgattcctattggaaaagccaaaatagaaaggcaaggaacacatataactgtggtt
tcccattcaagacctgtgggccactgcttagaagctgcagcagtgctatctaaagaagga
gttgaatgtgaggtgataaatatgcgtaccattagaccaatggacatggaaaccatagaa
gccagtgtcatgaagacaaatcatcttgtaactgtggaaggaggctggccacagtttgga
gtaggagctgaaatctgtgccaggatcatggaaggtcctgcgttcaatttcctggatgct
cctgctgttcgtgtcactggtgctgatgtccctatgccttatgcaaagattctagaggac
aactctatacctcaggtcaaagacatcatatttgcaataaagaaaacattaaatatttag

Protein sequence

>5162 : length: 359
MAAVSGLVRRPLREVSGLLKRRFHWTAPAALQVTVRDAINQGMDEELERDEKVFLLGEEV
AQYDGAYKVSRGLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAI
DQVINSAAKTYYMSGGLQPVPIVFRGPNGASAGVAAQHSQCFAAWYGHCPGLKVVSPWNS
EDAKGLIKSAIRDNNPVVVLENELMYGVPFEFPPEAQSKDFLIPIGKAKIERQGTHITVV
SHSRPVGHCLEAAAVLSKEGVECEVINMRTIRPMDMETIEASVMKTNHLVTVEGGWPQFG
VGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSIPQVKDIIFAIKKTLNI



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min