Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

5211, PFKL

Enzyme Number

2.7.1.11

RLRdb entry

RL00238

Organisms

Human (9606)

Synonyms

DKFZp686G1648|DKFZp686L2097|FLJ30173|FLJ40909|PFK-B;
PFKL;
phosphofructokinase, liver;
6-phosphofructokinase, liver type|liver phosphofructokinase|liver-type 1-phosphofructokinase|phosphofructo-1-kinase isozyme B|phosphofructokinase 1|phosphohexokinase

Description

phosphofructokinase, liver

Xrefs

HGNC:8876| MIM:171860| Ensembl:ENSG00000141959| HPRD:01385

Chromosome

21 : 21q22.3

Links to iHOP

5211

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

5211 10980 PMID: 16169070
5211 83755 PMID: 16189514
5211 55660 PMID: 16189514

Sequence Information

Nucleotide sequence

>5211 : length: 2343
atggccgcggtggacctggagaagctgcgggcgtcgggcgcgggcaaggccatcggcgtc
ctgaccagcggcggcgacgcgcaaggcatgaacgctgctgtccgggctgtgacgcgcatg
ggcatttatgtgggtgccaaagtcttcctcatctacgagggctatgagggcctcgtggag
ggaggtgagaacatcaagcaggccaactggctgagcgtctccaacatcatccagctgggc
ggcactatcattggcagcgctcgctgcaaggcctttaccaccagggaggggcgccgggca
gcggcctacaacctggtccagcacggcatcaccaacctgtgcgtcatcggcggggatggc
agcctcacaggtgccaacatcttccgcagcgagtggggcagcctgctggaggagctggtg
gcggaaggtaagatctcagagactacagcccggacctactcgcacctgaacatcgcgggc
ctagtgggctccatcgataacgacttctgcggcaccgacatgaccatcggcacggactcg
gccctccaccgcatcatggaggtcatcgatgccatcaccaccactgcccagagccaccag
aggaccttcgtgctggaagtgatgggccggcactgcgggtacctggcgctggtatctgca
ctggcctcaggggccgactggctgttcatccccgaggctccacccgaggacggctgggag
aacttcatgtgtgagaggctgggtgagactcggagccgtgggtcccgactgaacatcatc
atcatcgctgagggtgccattgaccgcaacgggaagcccatctcgtccagctacgtgaag
gacctggtggttcagaggctgggcttcgacacccgtgtaactgtgctgggccacgtgcag
cggggagggacgccctctgccttcgaccggatcctgagcagcaagatgggcatggaggcg
gtgatggcgctgctggaagccacgcctgacacgccggcctgcgtggtcaccctctcgggg
aaccagtcagtgcggctgcccctcatggagtgcgtgcagatgaccaaggaagtgcagaaa
gccatggatgacaagaggtttgacgaggccacccagctccgtggtgggagcttcgagaac
aactggaacatttacaagctcctcgcccaccagaagccccccaaggagaagtctaacttc
tccctggccatcctgaatgtgggggccccggcggctggcatgaatgcggccgtgcgctcg
gcggtgcggaccggcatctcccatggacacacagtatacgtggtgcacgatggcttcgaa
ggcctagccaagggtcaggtgcaagaagtaggctggcacgacgtggccggctggttgggg
cgtggtggctccatgctggggaccaagaggaccctgcccaagggccagctggagtccatt
gtggagaacatccgcatctatggtattcacgccctgctggtggtcggtgggtttgaggcc
tatgaaggggtgctgcagctggtggaggctcgcgggcgctacgaggagctctgcatcgtc
atgtgtgtcatcccagccaccatcagcaacaacgtccctggcaccgacttcagcctgggc
tccgacactgctgtaaatgccgccatggagagctgtgaccgcatcaaacagtctgcctcg
gggaccaagcgccgtgtgttcatcgtggagaccatggggggttactgtggctacctggcc
accgtgactggcattgctgtgggggccgacgccgcctacgtcttcgaggaccctttcaac
atccacgacttaaaggtcaacgtggagcacatgacggagaagatgaagacagacattcag
aggggcctggtgctgcggaacgagaagtgccatgactactacaccacggagttcctgtac
aacctgtactcatcagagggcaagggcgtcttcgactgcaggaccaatgtcctgggccac
ctgcagcagggtggcgctccaaccccctttgaccggaactatgggaccaagctgggggtg
aaggccatgctgtggttgtcggagaagctgcgcgaggtttaccgcaagggacgggtgttc
gccaatgccccagactcggcctgcgtgatcggcctgaagaagaaggcggtggccttcagc
cccgtcactgagctcaagaaagacactgatttcgagcaccgcatgccacgggagcagtgg
tggctgagcctgcggctcatgctgaagatgctggcacaataccgcatcagtatggccgcc
tacgtgtcaggggagctggagcacgtgacccgccgcaccctgagcatggacaagggcttc
tga

Protein sequence

>5211 : length: 780
MAAVDLEKLRASGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
GGENIKQANWLSVSNIIQLGGTIIGSARCKAFTTREGRRAAAYNLVQHGITNLCVIGGDG
SLTGANIFRSEWGSLLEELVAEGKISETTARTYSHLNIAGLVGSIDNDFCGTDMTIGTDS
ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
NFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPISSSYVKDLVVQRLGFDTRVTVLGHVQ
RGGTPSAFDRILSSKMGMEAVMALLEATPDTPACVVTLSGNQSVRLPLMECVQMTKEVQK
AMDDKRFDEATQLRGGSFENNWNIYKLLAHQKPPKEKSNFSLAILNVGAPAAGMNAAVRS
AVRTGISHGHTVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKGQLESI
VENIRIYGIHALLVVGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
IHDLKVNVEHMTEKMKTDIQRGLVLRNEKCHDYYTTEFLYNLYSSEGKGVFDCRTNVLGH
LQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANAPDSACVIGLKKKAVAFS
PVTELKKDTDFEHRMPREQWWLSLRLMLKMLAQYRISMAAYVSGELEHVTRRTLSMDKGF



Basic Information

Gene ID

5213, PFKM

Enzyme Number

2.7.1.11

RLRdb entry

RL00238

Organisms

Human (9606)

Synonyms

GSD7|MGC8699|PFK-1|PFK-M|PFKX;
PFKM;
phosphofructokinase, muscle;
phosphofructokinase, muscle type|phosphofructokinase, polypeptide X

Description

phosphofructokinase, muscle

Xrefs

HGNC:8877| MIM:610681| Ensembl:ENSG00000152556| HPRD:01988

Chromosome

12 : 12q13.3

Links to iHOP

5213

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

5213 859 PMID: 9252390
5213 8655 PMID: 14760703
5213 50617 PMID: 12649290
5213 2274 PMID: 12432079

Sequence Information

Nucleotide sequence

>5213 : length: 2343
atgacccatgaagagcaccatgcagccaaaaccctggggattggcaaagccattgctgtc
ttaacctctggtggagatgcccaaggtatgaatgctgctgtcagggctgtggttcgagtt
ggtatcttcaccggtgcccgtgtcttctttgtccatgagggttatcaaggcctggtggat
ggtggagatcacatcaaggaagccacctgggagagcgtttcgatgatgcttcagctggga
ggcacggtgattggaagtgcccggtgcaaggactttcgggaacgagaaggacgactccga
gctgcctacaacctggtgaagcgtgggatcaccaatctctgtgtcattgggggtgatggc
agcctcactggggctgacaccttccgttctgagtggagtgacttgttgagtgacctccag
aaagcaggtaagatcacagatgaggaggctacgaagtccagctacctgaacattgtgggc
ctggttgggtcaattgacaatgacttctgtggcaccgatatgaccattggcactgactct
gccctgcatcggatcatggaaattgtagatgccatcactaccactgcccagagccaccag
aggacatttgtgttagaagtaatgggccgccactgtggatacctggcccttgtcacctct
ctgtcctgtggggccgactgggtttttattcctgaatgtccaccagatgacgactgggag
gaacacctttgtcgccgactcagcgagacaaggacccgtggttctcgtctcaacatcatc
attgtggctgagggtgcaattgacaagaatggaaaaccaatcacctcagaagacatcaag
aatctggtggttaagcgtctgggatatgacacccgggttactgtcttggggcatgtgcag
aggggtgggacgccatcagcctttgacagaattctgggcagcaggatgggtgtggaagca
gtgatggcacttttggaggggaccccagataccccagcctgtgtagtgagcctctctggt
aaccaggctgtgcgcctgcccctcatggaatgtgtccaggtgaccaaagatgtgaccaag
gccatggatgagaagaaatttgacgaagccctgaagctgagaggccggagcttcatgaac
aactgggaggtgtacaagcttctagctcatgtcagacccccggtatctaagagtggttcg
cacacagtggctgtgatgaacgtgggggctccggctgcaggcatgaatgctgctgttcgc
tccactgtgaggattggccttatccagggcaaccgagtgctcgttgtccatgatggtttc
gagggcctggccaaggggcagatagaggaagctggctggagctatgttgggggctggact
ggccaaggtggctctaaacttgggactaaaaggactctacccaagaagagctttgaacag
atcagtgccaatataactaagtttaacattcagggccttgtcatcattgggggctttgag
gcttacacagggggcctggaactgatggagggcaggaagcagtttgatgagctctgcatc
ccatttgtggtcattcctgctacagtctccaacaatgtccctggctcagacttcagcgtt
ggggctgacacagcactcaatactatctgcacaacctgtgaccgcatcaagcagtcagca
gctggcaccaagcgtcgggtgtttatcattgagactatgggtggctactgtggctacctg
gctaccatggctggactggcagctggggccgatgctgcctacatttttgaggagcccttc
accattcgagacctgcaggcaaatgttgaacatctggtgcaaaagatgaaaacaactgtg
aaaaggggcttggtgttaaggaatgaaaagtgcaatgagaactataccactgacttcatt
ttcaacctgtactctgaggaggggaagggcatcttcgacagcaggaagaatgtgcttggt
cacatgcagcagggtgggagcccaaccccatttgataggaattttgccactaagatgggc
gccaaggctatgaactggatgtctgggaaaatcaaagagagttaccgtaatgggcggatc
tttgccaatactccagattcgggctgtgttctggggatgcgtaagagggctctggtcttc
caaccagtggctgagctgaaggaccagacagattttgagcatcgaatccccaaggaacag
tggtggctgaaactgaggcccatcctcaaaatcctagccaagtacgagattgacttggac
acttcagaccatgcccacctggagcacatcacccggaagcggtccggggaagctgccgtc
taa

Protein sequence

>5213 : length: 780
MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTK
AMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVR
STVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQ
ISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSV
GADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPF
TIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLG
HMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVF
QPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHITRKRSGEAAV



Basic Information

Gene ID

5214, PFKP

Enzyme Number

2.7.1.11

RLRdb entry

RL00238

Organisms

Human (9606)

Synonyms

RP11-298E9.2;
FLJ40226|PFK-C|PFKF;
PFKP;
phosphofructokinase, platelet;
OTTHUMP00000018966|Phosphofructokinase, platelet type

Description

phosphofructokinase, platelet

Xrefs

HGNC:8878| MIM:171840| Ensembl:ENSG00000067057| HPRD:01384

Chromosome

10 : 10p15.3-p15.2

Links to iHOP

5214

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

5214 8655 PMID: 14760703
5214 4163 PMID: 17353931

Sequence Information

Nucleotide sequence

>5214 : length: 2355
atggacgcggacgactcccgggcccccaagggctccttgcggaagttcctggagcacctc
tccggggccggcaaggccatcggcgtgctgaccagcggcggggatgctcaaggtatgaac
gctgccgtccgtgccgtggtgcgcatgggtatctacgtgggggccaaggtgtacttcatc
tacgagggctaccagggcatggtggacggaggctcaaacatcgcagaggccgactgggag
agtgtctccagcatcctgcaagtgggcgggacgatcattggcagtgcgcggtgccaggcc
ttccgcacgcgggaaggccgcctgaaggctgcttgcaacctgctgcagcgcggcatcacc
aacctgtgtgtgatcggcggggacgggagcctcaccggggccaacctcttccggaaggag
tggagtgggctgctggaggagctggccaggaacggccagatcgataaggaggccgtgcag
aagtacgcctacctcaacgtggtgggcatggtgggctccatcgacaatgatttctgcggc
accgacatgaccatcggcacggactccgccctgcacaggatcatcgaggtcgtcgacgcc
atcatgaccacggcccagagccaccagaggaccttcgttctggaggtgatgggacgacac
tgtgggtacctggccctggtgagtgccttggcctgcggtgcggactgggtgttccttcca
gaatctccaccagaggaaggctgggaggagcagatgtgtgtcaaactctcggagaaccgt
gcccggaaaaaaaggctgaatattattattgtggctgaaggagcaattgatacccaaaat
aaacccatcacctctgagaaaatcaaagagcttgtcgtcacgcagctgggctatgacaca
cgtgtgaccatcctcgggcacgtgcagagaggagggaccccttcggcattcgacaggatc
ttggccagccgcatgggagtggaggcagtcatcgccttgctagaggccaccccggacacc
ccagcttgcgtcgtgtcactgaacgggaaccacgccgtgcgcctgccgctgatggagtgc
gtgcagatgactcaggatgtgcagaaggcgatggacgagaggagatttcaagatgcggtt
cgactccgagggaggagctttgcgggcaacctgaacacctacaagcgacttgccatcaag
ctgccggatgatcagatcccaaagaccaattgcaacgtagctgtcatcaacgtgggggca
cccgcggctgggatgaacgcagccgtacgctcagctgtgcgcgtgggcattgccgacggc
cacaggatgctcgccatctatgatggctttgacggcttcgccaagggccagatcaaagaa
atcggctggacagatgtcgggggctggaccggccaaggaggctccattcttgggacaaaa
cgcgttctcccggggaagtacttggaagagatcgccacacagatgcgcacgcacagcatc
aacgcgctgctgatcatcggtggattcgaggcctacctgggactcctggagctgtcagcc
gcccgggagaagcacgaggagttctgtgtccccatggtcatggttcccgctactgtgtcc
aacaatgtgccgggttccgatttcagcatcggggcagacaccgccctgaacactatcacc
gacacctgcgaccgcatcaagcagtccgccagcggaaccaagcggcgcgtgttcatcatc
gagaccatgggcggctactgtggctacctggccaacatgggggggctcgcggccggagct
gatgccgcatacattttcgaagagcccttcgacatcagggatctgcagtccaacgtggag
cacctgacggagaaaatgaagaccaccatccagagaggccttgtgctcagaaatgagagc
tgcagtgaaaactacaccaccgacttcatttaccagctgtattcagaagagggcaaaggc
gtgtttgactgcaggaagaacgtgctgggtcacatgcagcagggtggggcaccctctcca
tttgatagaaactttggaaccaaaatctctgccagagctatggagtggatcactgcaaaa
ctcaaggaggcccggggcagaggaaaaaaatttaccaccgatgattccatttgtgtgctg
ggaataagcaaaagaaacgttatttttcaacctgtggcagagctgaagaagcaaacggat
tttgagcacaggattcccaaagaacagtggtggctcaagctacggcccctcatgaaaatc
ctggccaagtacaaggccagctatgacgtgtcggactcaggccagctggaacatgtgcag
ccctggagtgtctga

Protein sequence

>5214 : length: 784
MDADDSRAPKGSLRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFI
YEGYQGMVDGGSNIAEADWESVSSILQVGGTIIGSARCQAFRTREGRLKAACNLLQRGIT
NLCVIGGDGSLTGANLFRKEWSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCG
TDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPEEGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLNGNHAVRLPLMEC
VQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGA
PAAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTK
RVLPGKYLEEIATQMRTHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVS
NNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGA
DAAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKG
VFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITAKLKEARGRGKKFTTDDSICVL
GISKRNVIFQPVAELKKQTDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVQ
PWSV



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min