Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

5471, PPAT

Enzyme Number

2.4.2.14

RLRdb entry

RL00276

Organisms

Human (9606)

Synonyms

ATASE|GPAT|PRAT;
PPAT;
phosphoribosyl pyrophosphate amidotransferase;
amidophosphoribosyltransferase|glutamine PRPP amidotransferase|glutamine phosphoribosylpyrophosphatate amidotransferase

Description

phosphoribosyl pyrophosphate amidotransferase

Xrefs

HGNC:9238| MIM:172450| Ensembl:ENSG00000128059| HPRD:01402

Chromosome

4 : 4q12

Links to iHOP

5471

Sequence Information

Nucleotide sequence

>5471 : length: 1554
atggagctggaggagttggggatccgagaggaatgtggcgtgttcgggtgcatcgcctca
ggagagtggcccacgcagctggatgtaccgcatgtgatcactctgggactcgtggggctg
cagcaccggggtcaggagagtgctggtattgtgactagtgatgggagttcggtgccaaca
ttcaaatcacacaagggaatgggtcttgtaaatcacgtctttactgaagacaatttgaaa
aaattatatgtttcaaatcttggaattggacacaccaggtatgccaccacaggaaaatgt
gaactagaaaattgtcagcccttcgttgttgaaacacttcatgggaagatagctgtggca
cataatggcgaattggtaaatgctgctcgattaaggaaaaagcttctgcgtcatggtatt
ggtctgtctacaagttctgatagtgaaatgattacccagttactggcgtatacccctcct
caggaacaagatgacaccccagactgggtagccaggattaaaaacttgatgaaggaagca
cccacagcatactccctgcttataatgcacagagatgttatttatgcagtacgagatcct
tatggaaatcgtcccttatgcattggtcgtcttattccagtgtctgatataaatgacaaa
gagaaaaaaacatcagaaacagaaggatgggtggtgtcttcagaatcttgtagcttctta
tctattggtgcaagatattaccgtgaagtcttgcctggagaaattgtggaaatatccaga
cacaatgtccaaactcttgatattatatcaaggtctgaaggaaacccagtggctttttgt
atctttgaatatgtttattttgcaagaccagacagtatgttcgaagaccaaatggtttat
acagtaagataccgttgtggccagcagctagcgattgaagcacctgtggatgcagatttg
gttagcactgttccagaatctgctacgcctgctgctcttgcttacgcaggaaagtgtgga
cttccatatgtggaggtgctgtgtaaaaaccggtatgtagggagaaccttcattcagcca
aacatgaggttaagacaacttggtgttgcaaaaaaatttggagtattgtcagacaacttt
aaaggcaaaagaattgttcttgtagatgattcaattgtcagaggcaataccatctcacct
ataataaaactgctcaaagaatctggtgcaaaagaggtacacattcgagtagcttcacca
ccaattaaatatccatgcttcatgggaataaacattcctacaaaagaagagctcattgcc
aataaaccagaatttgatcaccttgcagaatatctaggagcaaacagtgttgtgtatctg
tcagtagaaggactggtttcatctgtacaagaagggataaagtttaaaaaacagaaagag
aaaaagcacgatattatgatccaagaaaatggaaatggtctggaatgttttgaaaagagt
ggtcattgtacagcttgtctcactggaaaatatcctgtagaattagaatggtag

Protein sequence

>5471 : length: 517
MELEELGIREECGVFGCIASGEWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPT
FKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVA
HNGELVNAARLRKKLLRHGIGLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEA
PTAYSLLIMHRDVIYAVRDPYGNRPLCIGRLIPVSDINDKEKKTSETEGWVVSSESCSFL
SIGARYYREVLPGEIVEISRHNVQTLDIISRSEGNPVAFCIFEYVYFARPDSMFEDQMVY
TVRYRCGQQLAIEAPVDADLVSTVPESATPAALAYAGKCGLPYVEVLCKNRYVGRTFIQP
NMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASP
PIKYPCFMGINIPTKEELIANKPEFDHLAEYLGANSVVYLSVEGLVSSVQEGIKFKKQKE
KKHDIMIQENGNGLECFEKSGHCTACLTGKYPVELEW



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min