Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

56632, Sphk2

Enzyme Number

2.7.1.91

RLRdb entry

RL00415

Organisms

Mouse (10090)

Synonyms

C76851|MGC102297;
Sphk2;
sphingosine kinase 2;
OTTMUSP00000026912|OTTMUSP00000026913|OTTMUSP00000026914

Description

sphingosine kinase 2

Xrefs

MGI:1861380| Ensembl:ENSMUSG00000057342

Chromosome

7 : 7 B4

Links to iHOP

56632

Sequence Information

Nucleotide sequence

>56632 : length: 1854
atggccccaccaccactactgccagtggctgccagcactccaatcctgcacggcgagttt
ggttcctacccggccaacggcccacggtttgccctcaccctcacaacacaagccctacac
atacagcgactacgcccaaagccagaagcccggccccgagatggtctagtctctctggat
gaggtctcgggctgtggcaccctgcagagccgtagccccgaggacactgcagcctacttc
tgcatctacacctacccacgtggccgtcgagggggccggcgcagagctacgcggaccttc
cgggcggatggggccaccacttatgaggagaatcgtgcagaggcccagcgctgggccact
gccctcacgtgtctcctccgaggagtgcctctgtcaggggaccaggaaatcacccctgaa
ttgctgccccggaagcccaggctgctcatattggtcaatccctttggggggcggggcctg
gcctggcagcgctgtatggaccacgtggtgccaatgatctctgaagctgggctgtccttc
aacctcatacagacagaacgacagaaccatgcccgtgagctggtgcaggggttaagcctg
agtgagtgggaaggcattgtcactgtgtctggagacgggctgctttacgaggtgctgaat
gggctccttgatcggccagactgggaggatgccgtgcggatgcccattggtgtcctcccc
tgtggatcgggcaatgcgctagctggggcggtgaaccatcatggcgggtttgagcaggtt
gtcggtgttgacctgttgctcaactgctcgcttcttctctgccgtggtggcagccatcct
ctggacctgctctctgtgacgctagcctcgggatcccgctgtttttccttcctgtcagtg
gcctggggattcttgtcagatgtggacattcacagtgagcgcttcagggccctgggcagc
gctcgattcacactgggtgcagtgctaggcctggcctcgttgcatacctaccgtggacgc
ctctcctacctccccgctaccacagaaccagccttgcccatcccaggccacagtctgcct
cgagccaagtcagaactagtcttggctccagccccagcccccgccgccacccactcgcct
ctacatcgatctgtgtctgacctgcccctgccccttccccagcctgccttggtctcccct
ggctcccctgagcccctgcctgacctgtccctcaatggtggtggtccagagctgactgga
gactggggaggagctggggatgcacctctgtccccagacccactgctgccttcatccccc
aacgctctcaaaacagctcagctttcacccatcgctgaagggcccccagaaatgccagca
tcttcggggttcctgcctcccacccacagtgccccagaagcctctacctggggcccagtg
gaccacctcctccctcccctgggctctccactgccccaagactgggtgacaatagagggg
gagtttgtactcatgttgggcatcttgccgagccacctctgcgcagacctgatggcagcc
ccacatgcacgctttgatgatggcgttgtgcacctgtgttgggtgcggagcggcatctca
cgggctgcacttctacgcattttgctggccatggagcatggaaaccacttcagcctgggc
tgcccccatctgggctatgctgcagcacgtgccttccgccttgaaccactcacgcctcgt
ggcctgctcactgtagatggggagttagtggagtatgggccaatacaggcgcaggtgcac
ccaggtctcgccacgctgctcactgggcctgcaggtcaaaagccacaagcctga

Protein sequence

>56632 : length: 617
MAPPPLLPVAASTPILHGEFGSYPANGPRFALTLTTQALHIQRLRPKPEARPRDGLVSLD
EVSGCGTLQSRSPEDTAAYFCIYTYPRGRRGGRRRATRTFRADGATTYEENRAEAQRWAT
ALTCLLRGVPLSGDQEITPELLPRKPRLLILVNPFGGRGLAWQRCMDHVVPMISEAGLSF
NLIQTERQNHARELVQGLSLSEWEGIVTVSGDGLLYEVLNGLLDRPDWEDAVRMPIGVLP
CGSGNALAGAVNHHGGFEQVVGVDLLLNCSLLLCRGGSHPLDLLSVTLASGSRCFSFLSV
AWGFLSDVDIHSERFRALGSARFTLGAVLGLASLHTYRGRLSYLPATTEPALPIPGHSLP
RAKSELVLAPAPAPAATHSPLHRSVSDLPLPLPQPALVSPGSPEPLPDLSLNGGGPELTG
DWGGAGDAPLSPDPLLPSSPNALKTAQLSPIAEGPPEMPASSGFLPPTHSAPEASTWGPV
DHLLPPLGSPLPQDWVTIEGEFVLMLGILPSHLCADLMAAPHARFDDGVVHLCWVRSGIS
RAALLRILLAMEHGNHFSLGCPHLGYAAARAFRLEPLTPRGLLTVDGELVEYGPIQAQVH
PGLATLLTGPAGQKPQA



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min