Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

57678, GPAM

Enzyme Number

2.3.1.15

RLRdb entry

RL00063

Organisms

Human (9606)

Synonyms

GPAT1|KIAA1560|MGC26846|RP11-426E5.2;
GPAM;
glycerol-3-phosphate acyltransferase, mitochondrial;
glycerol 3-phosphate acyltransferase, mitochondrial|mitochondrial glycerol 3-phosphate acyltransferase

Description

glycerol-3-phosphate acyltransferase, mitochondrial

Xrefs

HGNC:24865| MIM:602395| Ensembl:ENSG00000119927| HPRD:03865

Chromosome

10 : 10q25.2

Links to iHOP

57678

Sequence Information

Nucleotide sequence

>57678 : length: 2487
atggatgaatctgcactgacccttggtacaatagatgtttcttatctgccacattcatca
gaatacagtgttggtcgatgtaagcacacaagtgaggaatggggtgagtgtggctttaga
cccaccatcttcagatctgcaactttaaaatggaaagaaagcctaatgagtcggaaaagg
ccatttgttggaagatgttgttactcctgcactccccagagctgggacaaatttttcaac
cccagtatcccgtctttgggtttgcggaatgttatttatatcaatgaaactcacacaaga
caccgcggatggcttgcaagacgcctttcttacgttctttttattcaagagcgagatgtg
cataagggcatgtttgccaccaatgtgactgaaaatgtgctgaacagcagtagagtacaa
gaggcaattgcagaagtggctgctgaattaaaccctgatggttctgcccagcagcaatca
aaagccgttaacaaagtgaaaaagaaagctaaaaggattcttcaagaaatggttgccact
gtctcaccggcaatgatcagactgactgggtgggtgctgctaaaactgttcaacagcttc
ttttggaacattcaaattcacaaaggtcaacttgagatggttaaagctgcaactgagacg
aatttgccgcttctgtttctaccagttcatagatcccatattgactatctgctgctcact
ttcattctcttctgccataacatcaaagcaccatacattgcttcaggcaataatctcaac
atcccaatcttcagtaccttgatccataagcttgggggcttcttcatacgacgaaggctc
gatgaaacaccagatggacggaaagatgttctctatagagctttgctccatgggcatata
gttgaattacttcgacagcagcaattcttggagatcttcctggaaggcacacgttctagg
agtggaaaaacctcttgtgctcgggcaggacttttgtcagttgtggtagatactctgtct
accaatgtcatcccagacatcttgataatacctgttggaatctcctatgatcgcattatc
gaaggtcactacaatggtgaacaactgggcaaacctaagaagaatgagagcctgtggagt
gtagcaagaggtgttattagaatgttacgaaaaaactatggttgtgtccgagtggatttt
gcacagccattttccttaaaggaatatttagaaagccaaagtcagaaaccggtgtctgct
ctactttccctggagcaagcgttgttaccagctatacttccttcaagacccagtgatgct
gctgatgaaggtagagacacgtccattaatgagtccagaaatgcaacagatgaatcccta
cgaaggaggttgattgcaaatctggctgagcatattctattcactgctagcaagtcctgt
gccattatgtccacacacattgtggcttgcctgctcctctacagacacaggcagggaatt
gatctctccacattggtcgaagacttctttgtgatgaaagaggaagtcctggctcgtgat
tttgacctggggttctcaggaaattcagaagatgtagtaatgcatgccatacagctgctg
ggaaattgtgtcacaatcacccacactagcaggaacgatgagttttttatcacccccagc
acaactgtcccatcagtcttcgaactcaacttctacagcaatggggtacttcatgtcttt
atcatggaggccatcatagcttgcagcctttatgcagttctgaacaagaggggactgggg
ggtcccactagcaccccacctaacctgatcagccaggagcagctggtgcggaaggcggcc
agcctgtgctaccttctctccaatgaaggcaccatctcactgccttgccagacattttac
caagtctgccatgaaacagtaggaaagtttatccagtatggcattcttacagtggcagag
cacgatgaccaggaagatatcagtcctagtcttgctgagcagcagtgggacaagaagctt
ccagaacctttgtcttggagaagtgatgaagaagatgaagacagtgactttggggaggaa
cagcgagattgctacctgaaggtgagccaatccaaggagcaccagcagtttatcaccttc
ttacagagactccttgggcctttgctggaggcctacagctctgctgccatctttgttcac
aacttcagtggtcctgttccagaacctgagtatctgcaaaagttgcacaaatacctaata
accagaacagaaagaaatgttgcagtatatgctgagagtgccacatattgtcttgtgaag
aatgctgtgaaaatgtttaaggatattggggttttcaaggagaccaaacaaaagagagtg
tctgttttagaactgagcagcacttttctacctcaatgcaaccgacaaaaacttctagaa
tatattctgagttttgtggtgctgtag

Protein sequence

>57678 : length: 828
MDESALTLGTIDVSYLPHSSEYSVGRCKHTSEEWGECGFRPTIFRSATLKWKESLMSRKR
PFVGRCCYSCTPQSWDKFFNPSIPSLGLRNVIYINETHTRHRGWLARRLSYVLFIQERDV
HKGMFATNVTENVLNSSRVQEAIAEVAAELNPDGSAQQQSKAVNKVKKKAKRILQEMVAT
VSPAMIRLTGWVLLKLFNSFFWNIQIHKGQLEMVKAATETNLPLLFLPVHRSHIDYLLLT
FILFCHNIKAPYIASGNNLNIPIFSTLIHKLGGFFIRRRLDETPDGRKDVLYRALLHGHI
VELLRQQQFLEIFLEGTRSRSGKTSCARAGLLSVVVDTLSTNVIPDILIIPVGISYDRII
EGHYNGEQLGKPKKNESLWSVARGVIRMLRKNYGCVRVDFAQPFSLKEYLESQSQKPVSA
LLSLEQALLPAILPSRPSDAADEGRDTSINESRNATDESLRRRLIANLAEHILFTASKSC
AIMSTHIVACLLLYRHRQGIDLSTLVEDFFVMKEEVLARDFDLGFSGNSEDVVMHAIQLL
GNCVTITHTSRNDEFFITPSTTVPSVFELNFYSNGVLHVFIMEAIIACSLYAVLNKRGLG
GPTSTPPNLISQEQLVRKAASLCYLLSNEGTISLPCQTFYQVCHETVGKFIQYGILTVAE
HDDQEDISPSLAEQQWDKKLPEPLSWRSDEEDEDSDFGEEQRDCYLKVSQSKEHQQFITF
LQRLLGPLLEAYSSAAIFVHNFSGPVPEPEYLQKLHKYLITRTERNVAVYAESATYCLVK
NAVKMFKDIGVFKETKQKRVSVLELSSTFLPQCNRQKLLEYILSFVVL



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min