Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

856626, IMD2

Enzyme Number

1.1.1.205

RLRdb entry

RL00417

Organisms

Yeast (4932)

Synonyms

YHR216W;
PUR5;
Inosine monophosphate dehydrogenase, catalyzes the first step of GMP biosynthesis, expression is induced by mycophenolic acid resulting in resistance to the drug, expression is repressed by nutrient limitation

Description

Imd2p

Xrefs

SGD:S000001259

Chromosome

VIII : -

Links to iHOP

856626

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 855547 PMID: 11805837
856626 856885 PMID: 11805837
856626 856610 PMID: 17200106
856626 855044 PMID: 16429126
856626 855819 PMID: 16319894
856626 851196 PMID: 16429126
856626 851152 PMID: 14759368
856626 851152 PMID: 16429126
856626 851152 PMID: 12746440
856626 851152 PMID: 17200106
856626 851152 PMID: 16554755
856626 850872 PMID: 16429126
856626 851988 PMID: 15584090
856626 853668 PMID: 16554755
856626 852248 PMID: 16429126
856626 852439 PMID: 16429126
856626 853344 PMID: 16429126
856626 852810 PMID: 11441018
856626 851477 PMID: 17200106
856626 856908 PMID: 11805837
856626 850623 PMID: 11804584
856626 851415 PMID: 11441018
856626 853178 PMID: 14519092
856626 853178 PMID: 11805837
856626 855083 PMID: 16429126
856626 851814 PMID: 16429126
856626 851814 PMID: 17200106
856626 852931 PMID: 16319894
856626 856776 PMID: 16554755
856626 855408 PMID: 16429126
856626 853419 PMID: 16429126
856626 855173 PMID: 17200106
856626 851147 PMID: 11805837
856626 851332 PMID: 16429126
856626 855532 PMID: 11283351
856626 854948 PMID: 16429126
856626 854948 PMID: 12746440
856626 854948 PMID: 17200106
856626 854948 PMID: 16554755
856626 854424 PMID: 16429126
856626 854424 PMID: 17200106

Sequence Information

Nucleotide sequence

>856626 : length: 1572
atggccgccattagagactacaagaccgcactagactttaccaagagcctaccaagaccg
gatggtttgtcagtgcaggaattgatggactccaagatcagaggtgggttgacttataac
gattttttaatcttaccaggtttagtcgattttgcgtcctctgaagttagcctacagacc
aagctaaccaggaatattactttaaatattccattagtttcctctccaatggacacggtg
acagagtcagaaatggccacttttatggctctgttgggtggtatcggtttcattcaccat
aactgtaccccagaggaccaagctgacatggtcagaagagtcaagaactatgaaaatggg
tttattaacaaccctatagtgatttctccaactacgaccgttggtgaagctaagagcatg
aaggaaaagtatggatttgcaggcttccctgtcacgacagatggaaagagaaatgcaaag
ttggtgggtgtcatcacctctcgtgatatacaattcgttgaggacaactctttactcgtt
caggatgtcatgaccaaaaaccctgttaccggcgcacaaggtatcacattatcagaaggt
aacgaaattctaaagaaaatcaaaaagggtaggctattggttgttgatgaaaagggtaac
ttagtttctatgctttcccgaactgatttaatgaaaaatcagaactacccattagcgtcc
aaatctgccaacaccaagcaactgttatgtggtgcttctattgggactatggacgctgat
aaagaaagactaagattattggtaaaagctgggttggatgtcgtcatattggattcatcc
caaggaaactctatcttcgaattgaacatgctcaagtgggtcaaagagagtttcccaggt
ctggaagtcatcgctggtaacgttgtcaccagggaacaagctgccaatttgattgctgcc
ggtgcggacggtttgagaattggtatgggaactggctctatttgtattacccaagaagtt
atggcttgtggtaggccacaaggtacagccgtctacaatgtgtgtgaatttgctaaccaa
ttcggtgttccatgtatggctgatggtggtgttcaaaacattggtcatattaccaaagct
ttggctcttggttcttctactgttatgatgggtggtatgttggccggtactaccgaatca
ccaggtgaatatttctatcaagatggtaaaagattgaaggcgtatcgtggtatgggctcc
attgacgccatgcaaaagactggtaccaaaggtaatgcatctacctcccgttacttttcc
gaatcagacagtgttttggtcgcacaaggtgtctccggtgctgtcgttgacaaaggatcc
attaagaaatttattccatatttgtacaatggtttacaacattcctgtcaagacatcggc
tgtaggtcgctaactttattaaagaataatgttcaaaggggtaaagttagatttgaattc
agaaccgcttctgctcaactagaaggtggcgttcataatttacattcttacgaaaagcgt
ttacataactga

Protein sequence

>856626 : length: 523
MAAIRDYKTALDFTKSLPRPDGLSVQELMDSKIRGGLTYNDFLILPGLVDFASSEVSLQT
KLTRNITLNIPLVSSPMDTVTESEMATFMALLGGIGFIHHNCTPEDQADMVRRVKNYENG
FINNPIVISPTTTVGEAKSMKEKYGFAGFPVTTDGKRNAKLVGVITSRDIQFVEDNSLLV
QDVMTKNPVTGAQGITLSEGNEILKKIKKGRLLVVDEKGNLVSMLSRTDLMKNQNYPLAS
KSANTKQLLCGASIGTMDADKERLRLLVKAGLDVVILDSSQGNSIFELNMLKWVKESFPG
LEVIAGNVVTREQAANLIAAGADGLRIGMGTGSICITQEVMACGRPQGTAVYNVCEFANQ
FGVPCMADGGVQNIGHITKALALGSSTVMMGGMLAGTTESPGEYFYQDGKRLKAYRGMGS
IDAMQKTGTKGNASTSRYFSESDSVLVAQGVSGAVVDKGSIKKFIPYLYNGLQHSCQDIG
CRSLTLLKNNVQRGKVRFEFRTASAQLEGGVHNLHSYEKRLHN



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min