Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

8611, PPAP2A

Enzyme Number

3.1.3.4

RLRdb entry

RL00253

Organisms

Human (9606)

Synonyms

LLP1a|LPP1|PAP-2a|PAP2|PAP2a2|PAP2alpha2|PAPalpha1;
PPAP2A;
phosphatidic acid phosphatase type 2A;
lipid phosphate phosphohydrolase 1|lipid phosphate phosphohydrolase 1a|phosphatidic acid phosphatase 2a|phosphatidic acid phosphohydrolase type 2a|type 2 phosphatidic acid phosphohydrolase|type-2 phosphatidic acid phosphatase alpha

Description

phosphatidic acid phosphatase type 2A

Xrefs

HGNC:9228| MIM:607124| Ensembl:ENSG00000067113| HPRD:06178

Chromosome

5 : 5q11

Links to iHOP

8611

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

8611 5348 PMID: 10087003
8611 29966 PMID: 10681496

Sequence Information

Nucleotide sequence

>8611 : length: 855
atgtttgacaagacgcggctgccgtacgtggccctcgatgtgctctgcgtgttgctggct
ggattgccttttgcaattcttacttcaaggcatacccccttccaacgaggagtattctgt
aatgatgagtccatcaagtacccttacaaagaagacaccataccttatgcgttattaggt
ggaataatcattccattcagtattatcgttattattcttggagaaaccctgtctgtttac
tgtaaccttttgcactcaaattcctttatcaggaataactacatagccactatttacaaa
gccattggaacctttttatttggtgcagctgctagtcagtccctgactgacattgccaag
tattcaataggcagactgcggcctcacttcttggatgtttgtgatccagattggtcaaaa
atcaactgcagcgatggttacattgaatactacatatgtcgagggaatgcagaaagagtt
aaggaaggcaggttgtccttctattcaggccactcttcgttttccatgtactgcatgctg
tttgtggcactttatcttcaagccaggatgaagggagactgggcaagactcttacgcccc
acactgcaatttggtcttgttgccgtatccatttatgtgggcctttctcgagtttctgat
tataaacaccactggagcgatgtgttgactggactcattcagggagctctggttgcaata
ttagttgctgtatatgtatcggatttcttcaaagaaagaacttcttttaaagaaagaaaa
gaggaggactctcatacaactctgcatgaaacaccaacaactgggaatcactatccgagc
aatcaccagccttga

Protein sequence

>8611 : length: 284
MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLG
GIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAK
YSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCML
FVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAI
LVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP



Basic Information

Gene ID

8612, PPAP2C

Enzyme Number

3.1.3.4

RLRdb entry

RL00253

Organisms

Human (9606)

Synonyms

LPP2|PAP-2c|PAP2-g;
PPAP2C;
phosphatidic acid phosphatase type 2C;
lipid phosphate phosphohydrolase 2|phosphatidic acid phosphohydrolase type 2c|type-2 phosphatidic acid phosphatase-gamma

Description

phosphatidic acid phosphatase type 2C

Xrefs

HGNC:9230| MIM:607126| Ensembl:ENSG00000141934| HPRD:06180

Chromosome

19 : 19p13

Links to iHOP

8612

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

8612 9094 PMID: 16169070
8612 7917 PMID: 16169070

Sequence Information

Nucleotide sequence

>8612 : length: 867
atgcagcggaggtgggtcttcgtgctgctcgacgtgctgtgcttactggtcgcctccctg
cccttcgctatcctgacgctggtgaacgccccgtacaagcgaggattttactgcggggat
gactccatccggtacccctaccgtccagataccatcacccacgggctcatggctggggtc
accatcacggccaccgtcatccttgtctcggccggggaagcctacctggtgtacacagac
cggctctattctcgctcggacttcaacaactacgtggctgctgtatacaaggtgctgggg
accttcctgtttggggctgccgtgagccagtctctgacagacctggccaagtacatgatt
gggcgtctgaggcccaacttcctagccgtctgcgaccccgactggagccgggtcaactgc
tcggtctatgtgcagctggagaaggtgtgcaggggaaaccctgctgatgtcaccgaggcc
aggttgtctttctactcgggacactcttcctttgggatgtactgcatggtgttcttggcg
ctgtatgtgcaggcacgactctgttggaagtgggcacggctgctgcgacccacagtccag
ttcttcctggtggcctttgccctctacgtgggctacacccgcgtgtctgattacaaacac
cactggagcgatgtccttgttggcctcctgcagggggcactggtggctgccctcactgtc
tgctacatctcagacttcttcaaagcccgacccccacagcactgtctgaaggaggaggag
ctggaacggaagcccagcctgtcactgacgttgaccctgggcgaggctgaccacaaccac
tatggatacccgcactcctcctcctga

Protein sequence

>8612 : length: 288
MQRRWVFVLLDVLCLLVASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGV
TITATVILVSAGEAYLVYTDRLYSRSDFNNYVAAVYKVLGTFLFGAAVSQSLTDLAKYMI
GRLRPNFLAVCDPDWSRVNCSVYVQLEKVCRGNPADVTEARLSFYSGHSSFGMYCMVFLA
LYVQARLCWKWARLLRPTVQFFLVAFALYVGYTRVSDYKHHWSDVLVGLLQGALVAALTV
CYISDFFKARPPQHCLKEEELERKPSLSLTLTLGEADHNHYGYPHSSS



Basic Information

Gene ID

8613, PPAP2B

Enzyme Number

3.1.3.4

RLRdb entry

RL00253

Organisms

Human (9606)

Synonyms

Dri42|LPP3|MGC15306|PAP-2b|PAP2-b|PAP2-beta|VCIP;
PPAP2B;
phosphatidic acid phosphatase type 2B;
OTTHUMP00000009855|lipid phosphate phosphohydrolase 3|phosphatidic acid phosphohydrolase 2b|type-2 phosphatidic acid phosphatase-beta|vascular endothelial growth factor and type I collagen inducible

Description

phosphatidic acid phosphatase type 2B

Xrefs

HGNC:9229| MIM:607125| Ensembl:ENSG00000162407| HPRD:06179

Chromosome

1 : 1pter-p22.1

Links to iHOP

8613

Sequence Information

Nucleotide sequence

>8613 : length: 936
atgcaaaactacaagtacgacaaagcgatcgtcccggagagcaagaacggcggcagcccg
gcgctcaacaacaacccgaggaggagcggcagcaagcgggtgctgctcatctgcctcgac
ctcttctgcctcttcatggcgggcctccccttcctcatcatcgagacaagcaccatcaag
ccttaccaccgagggttttactgcaatgatgagagcatcaagtacccactgaaaactggt
gagacaataaatgacgctgtgctctgtgccgtggggatcgtcattgccatcctcgcgatc
atcacgggggaattctaccggatctattacctgaagaagtcgcggtcgacgattcagaac
ccctacgtggcagcactctataagcaagtgggctgcttcctctttggctgtgccatcagc
cagtctttcacagacattgccaaagtgtccatagggcgcctgcgtcctcacttcttgagt
gtctgcaaccctgatttcagccagatcaactgctctgaaggctacattcagaactacaga
tgcagaggtgatgacagcaaagtccaggaagccaggaagtccttcttctctggccatgcc
tccttctccatgtacactatgctgtatttggtgctatacctgcaggcccgcttcacttgg
cgaggagcccgcctgctccggcccctcctgcagttcaccttgatcatgatggccttctac
acgggactgtctcgcgtatcagaccacaagcaccatcccagtgatgttctggcaggattt
gctcaaggagccctggtggcctgctgcatagttttcttcgtgtctgacctcttcaagact
aagacgacgctctccctgcctgcccctgctatccggaaggaaatcctttcacctgtggac
attattgacaggaacaatcaccacaacatgatgtag

Protein sequence

>8613 : length: 311
MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIK
PYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQN
PYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYR
CRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAFY
TGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRKEILSPVD
IIDRNNHHNMM



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min