Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

9945, GFPT2

Enzyme Number

2.6.1.16

RLRdb entry

RL00275

Organisms

Human (9606)

Synonyms

FLJ10380|GFAT2;
GFPT2;
glutamine-fructose-6-phosphate transaminase 2;
glutamine: fructose-6-phosphate aminotransferase 2

Description

glutamine-fructose-6-phosphate transaminase 2

Xrefs

HGNC:4242| MIM:603865| Ensembl:ENSG00000131459| HPRD:04842

Chromosome

5 : 5q34-q35

Links to iHOP

9945

Sequence Information

Nucleotide sequence

>9945 : length: 2049
atgtgcggaatctttgcctacatgaactacagagtcccccggacgaggaaggagatcttc
gaaaccctcatcaagggcctgcagcggctggagtacagaggctacgactcggcaggtgtg
gcgatcgatgggaataatcacgaagtcaaagaaagacacattcagctggtcaagaaaagg
gggaaagtcaaggctctcgatgaagaactttacaaacaagacagcatggacttaaaagtg
gagtttgagacacacttcggcattgcccacacgcgctgggccacccacggggtccccagt
gctgtcaacagccaccctcagcgctcagacaaaggcaacgaatttgttgtcatccacaat
gggatcatcacaaattacaaagatctgaggaaatttctggaaagcaaaggctacgagttt
gagtcagaaacagatacagagaccatcgccaagctgattaaatatgtgttcgacaacaga
gaaactgaggacattacgttttcaacgttggtcgagagagtcattcagcagttggaaggt
gcattcgcgctggttttcaagagtgtccactacccaggagaagccgttgccacacggaga
ggcagccccctgctcatcggagtccggagcaaatacaagctctccacagaacagatccct
atcttatacaggacgtgcactctggagaatgtgaagaatatctgtaagacacggatgaag
aggctggacagctccgcctgcctgcatgctgtgggcgacaaggccgtggaattcttcttt
gcttctgatgcaagcgctatcatagagcacaccaaccgggtcatcttcctggaggacgat
gacatcgccgcagtggctgatgggaaactctccattcaccgggtcaagcgctcggccagt
gatgacccatctcgagccatccagaccttgcagatggaactgcagcaaatcatgaaaggt
aacttcagtgcgtttatgcagaaggagatcttcgaacagccagaatcagttttcaatact
atgagaggtcgggtgaattttgaaaccaacacagtgctcctgggtggcttgaaggaccac
ttgaaggagattcgacgatgccgacggctcatcgtgattggctgtggaaccagctaccac
gctgccgtggctacgcggcaagttttggaggaactgactgagcttcctgtgatggttgaa
cttgctagtgattttctggacaggaacacacctgtgttcagggatgacgtttgctttttc
atcagccagtcaggcgagaccgcggacaccctcctggcgctgcgctactgtaaggaccgc
ggcgctctcaccgtgggcgtcaccaacaccgtgggcagctccatctctcgcgagaccgac
tgcggcgtccacatcaacgcagggccggagatcggcgtggccagcaccaaggcttatacc
agtcagttcatctctctggtgatgtttggtttgatgatgtctgaagaccgaatttcacta
caaaacaggaggcaagagatcatccgtggcttgagatctttacctgagctgatcaaggaa
gtgctgtctctggaggagaagatccacgacttggccctggagctctacacgcagagatcg
ctgctggtgatggggcggggctacaactatgccacctgcctggaaggagccctgaaaatt
aaagagataacctacatgcactcagaaggcatcctggctggggagctgaagcacgggccc
ctggcactgattgacaagcagatgcccgtcatcatggtcattatgaaggatccttgcttc
gccaaatgccagaacgccctgcagcaagtcacggcccgccagggtcgccccattatactg
tgctccaaggacgatactgaaagttccaagtttgcgtataagacaattgagctgccccac
actgtggactgcctccagggcatcctgagcgtgattccgctgcagctgctgtccttccac
ctggctgttctccgaggatatgacgttgacttccccagaaatctggccaagtctgtaact
gtggaatga

Protein sequence

>9945 : length: 682
MCGIFAYMNYRVPRTRKEIFETLIKGLQRLEYRGYDSAGVAIDGNNHEVKERHIQLVKKR
GKVKALDEELYKQDSMDLKVEFETHFGIAHTRWATHGVPSAVNSHPQRSDKGNEFVVIHN
GIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEG
AFALVFKSVHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPILYRTCTLENVKNICKTRMK
RLDSSACLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSAS
DDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDH
LKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFF
ISQSGETADTLLALRYCKDRGALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYT
SQFISLVMFGLMMSEDRISLQNRRQEIIRGLRSLPELIKEVLSLEEKIHDLALELYTQRS
LLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMVIMKDPCF
AKCQNALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH
LAVLRGYDVDFPRNLAKSVTVE



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min