Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

944834, aceE

Enzyme Number

1.2.4.1

RLRdb entry

RL00385

Organisms

E. coli (83333)

Synonyms

b0114;
ECK0113|JW0110;
-

Description

pyruvate dehydrogenase, decarboxylase component E1, thiamin-binding

Xrefs

ECOCYC:EG10024| EcoGene:EG10024

Chromosome

- : -

Links to iHOP

944834

Sequence Information

Nucleotide sequence

>b0114 : length: 2664
atgtcagaacgtttcccaaatgacgtggatccgatcgaaactcgcgactggctccaggcg
atcgaatcggtcatccgtgaagaaggtgttgagcgtgctcagtatctgatcgaccaactg
cttgctgaagcccgcaaaggcggtgtaaacgtagccgcaggcacaggtatcagcaactac
atcaacaccatccccgttgaagaacaaccggagtatccgggtaatctggaactggaacgc
cgtattcgttcagctatccgctggaacgccatcatgacggtgctgcgtgcgtcgaaaaaa
gacctcgaactgggcggccatatggcgtccttccagtcttccgcaaccatttatgatgtg
tgctttaaccacttcttccgtgcacgcaacgagcaggatggcggcgacctggtttacttc
cagggccacatctccccgggcgtgtacgctcgtgctttcctggaaggtcgtctgactcag
gagcagctggataacttccgtcaggaagttcacggcaatggcctctcttcctatccgcac
ccgaaactgatgccggaattctggcagttcccgaccgtatctatgggtctgggtccgatt
ggtgctatttaccaggctaaattcctgaaatatctggaacaccgtggcctgaaagatacc
tctaaacaaaccgtttacgcgttcctcggtgacggtgaaatggacgaaccggaatccaaa
ggtgcgatcaccatcgctacccgtgaaaaactggataacctggtcttcgttatcaactgt
aacctgcagcgtcttgacggcccggtcaccggtaacggcaagatcatcaacgaactggaa
ggcatcttcgaaggtgctggctggaacgtgatcaaagtgatgtggggtagccgttgggat
gaactgctgcgtaaggataccagcggtaaactgatccagctgatgaacgaaaccgttgac
ggcgactaccagaccttcaaatcgaaagatggtgcgtacgttcgtgaacacttcttcggt
aaatatcctgaaaccgcagcactggttgcagactggactgacgagcagatctgggcactg
aaccgtggtggtcacgatccgaagaaaatctacgctgcattcaagaaagcgcaggaaacc
aaaggcaaagcgacagtaatccttgctcataccattaaaggttacggcatgggcgacgcg
gctgaaggtaaaaacatcgcgcaccaggttaagaaaatgaacatggacggtgtgcgtcat
atccgcgaccgtttcaatgtgccggtgtctgatgcagatatcgaaaaactgccgtacatc
accttcccggaaggttctgaagagcatacctatctgcacgctcagcgtcagaaactgcac
ggttatctgccaagccgtcagccgaacttcaccgagaagcttgagctgccgagcctgcaa
gacttcggcgcgctgttggaagagcagagcaaagagatctctaccactatcgctttcgtt
cgtgctctgaacgtgatgctgaagaacaagtcgatcaaagatcgtctggtaccgatcatc
gccgacgaagcgcgtactttcggtatggaaggtctgttccgtcagattggtatttacagc
ccgaacggtcagcagtacaccccgcaggaccgcgagcaggttgcttactataaagaagac
gagaaaggtcagattctgcaggaagggatcaacgagctgggcgcaggttgttcctggctg
gcagcggcgacctcttacagcaccaacaatctgccgatgatcccgttctacatctattac
tcgatgttcggcttccagcgtattggcgatctgtgctgggcggctggcgaccagcaagcg
cgtggcttcctgatcggcggtacttccggtcgtaccaccctgaacggcgaaggtctgcag
cacgaagatggtcacagccacattcagtcgctgactatcccgaactgtatctcttacgac
ccggcttacgcttacgaagttgctgtcatcatgcatgacggtctggagcgtatgtacggt
gaaaaacaagagaacgtttactactacatcactacgctgaacgaaaactaccacatgccg
gcaatgccggaaggtgctgaggaaggtatccgtaaaggtatctacaaactcgaaactatt
gaaggtagcaaaggtaaagttcagctgctcggctccggttctatcctgcgtcacgtccgt
gaagcagctgagatcctggcgaaagattacggcgtaggttctgacgtttatagcgtgacc
tccttcaccgagctggcgcgtgatggtcaggattgtgaacgctggaacatgctgcacccg
ctggaaactccgcgcgttccgtatatcgctcaggtgatgaacgacgctccggcagtggca
tctaccgactatatgaaactgttcgctgagcaggtccgtacttacgtaccggctgacgac
taccgcgtactgggtactgatggcttcggtcgttccgacagccgtgagaacctgcgtcac
cacttcgaagttgatgcttcttatgtcgtggttgcggcgctgggcgaactggctaaacgt
ggcgaaatcgataagaaagtggttgctgacgcaatcgccaaattcaacatcgatgcagat
aaagttaacccgcgtctggcgtaa

Protein sequence

>b0114 : length: 887
MSERFPNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLAEARKGGVNVAAGTGISNY
INTIPVEEQPEYPGNLELERRIRSAIRWNAIMTVLRASKKDLELGGHMASFQSSATIYDV
CFNHFFRARNEQDGGDLVYFQGHISPGVYARAFLEGRLTQEQLDNFRQEVHGNGLSSYPH
PKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSKQTVYAFLGDGEMDEPESK
GAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIINELEGIFEGAGWNVIKVMWGSRWD
ELLRKDTSGKLIQLMNETVDGDYQTFKSKDGAYVREHFFGKYPETAALVADWTDEQIWAL
NRGGHDPKKIYAAFKKAQETKGKATVILAHTIKGYGMGDAAEGKNIAHQVKKMNMDGVRH
IRDRFNVPVSDADIEKLPYITFPEGSEEHTYLHAQRQKLHGYLPSRQPNFTEKLELPSLQ
DFGALLEEQSKEISTTIAFVRALNVMLKNKSIKDRLVPIIADEARTFGMEGLFRQIGIYS
PNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAGCSWLAAATSYSTNNLPMIPFYIYY
SMFGFQRIGDLCWAAGDQQARGFLIGGTSGRTTLNGEGLQHEDGHSHIQSLTIPNCISYD
PAYAYEVAVIMHDGLERMYGEKQENVYYYITTLNENYHMPAMPEGAEEGIRKGIYKLETI
EGSKGKVQLLGSGSILRHVREAAEILAKDYGVGSDVYSVTSFTELARDGQDCERWNMLHP
LETPRVPYIAQVMNDAPAVASTDYMKLFAEQVRTYVPADDYRVLGTDGFGRSDSRENLRH
HFEVDASYVVVAALGELAKRGEIDKKVVADAIAKFNIDADKVNPRLA



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min