Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Enzyme Number

1.14.13.17

RLRdb entry

RL00394

Organisms

Rattus norvegicus (Rat) (10116_rodents)

Synonyms

Cytochrome P450 7A1;
EC=1.14.13.17;
CYPVII;
Cholesterol 7-alpha-monooxygenase;
Cholesterol 7-alpha-hydroxylase;

Key words

Cholesterol metabolism, Endoplasmic reticulum, Heme, Iron, Lipid metabolism, Membrane, Metal-binding, Microsome, Monooxygenase, NADP, Oxidoreductase, Steroid metabolism

Links to iHOP

P18125

Enzyme regulation

Inhibition of activity by bile acid feedback.

Subcellular localization

Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein

Catalytic activity

Cholesterol + NADPH + O(2) = 7-alpha-hydroxycholesterol + NADP(+) + H(2)O

Gene ontology

F:iron ion binding
F:electron carrier activity
P:oxidation reduction
C:endoplasmic reticulum membrane
F:heme binding
F:cholesterol 7-alpha-monooxygenase activity
C:microsome

Tissue specificity

Liver.

Fasta

>P18125 : length: 503
MMTISLIWGIAVLVSCCIWFIVGIRRRKAGEPPLENGLIPYLGCALKFGSNPLEFLRANQ
RKHGHVFTCKLMGKYVHFITNSLSYHKVLCHGKYFDWKKFHYTTSAKAFGHRSIDPNDGN
TTENINNTFTKTLQGDALCSLSEAMMQNLQSVMRPPGLPKSKSNAWVTEGMYAFCYRVMF
EAGYLTLFGRDISKTDTQKALILNNLDNFKQFDQVFPALVAGLPIHLFKTAHKAREKLAE
GLKHKNLCVRDQVSELIRLRMFLNDTLSTFDDMEKAKTHLAILWASQANTIPATFWSLFQ
MIRSPEAMKAASEEVSGALQSAGQELSSGGSAIYLDQVQLNDLPVLDSIIKEALRLSSAS
LNIRTAKEDFTLHLEDGSYNIRKDDMIALYPQLMHLDPEIYPDPLTFKYDRYLDESGKAK
TTFYSNGNKLKCFYMPFGSGATICPGRLFAVQEIKQFLILMLSCFELEFVESQVKCPPLD
QSRAGLGILPPLHDIEFKYKLKH



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min