Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Enzyme Number

1.14.99.1

RLRdb entry

RL00448

Organisms

Rattus norvegicus (Rat) (10116_rodents)

Synonyms

Prostaglandin G/H synthase 2;
EC=1.14.99.1;
Cyclooxygenase-2;
Short=COX-2;
Prostaglandin-endoperoxide synthase 2;
Prostaglandin H2 synthase 2;
Short=PGH synthase 2;
Short=PGHS-2;
PHS II;
Flags: Precursor;

Key words

Dioxygenase, Direct protein sequencing, Endoplasmic reticulum, Fatty acid biosynthesis, Glycoprotein, Heme, Iron, Lipid synthesis, Membrane, Metal-binding, Microsome, Oxidoreductase, Peroxidase, Phosphoprotein, Prostaglandin biosynthesis, Signal

Links to iHOP

P35355

Function

May have a role as a major mediator of inflammation and/or a role for prostanoid signaling in activity-dependent plasticity.

Subcellular localization

Microsome membrane; Peripheral membrane protein. Endoplasmic reticulum membrane; Peripheral membrane protein

Catalytic activity

Arachidonate + AH(2) + 2 O(2) = prostaglandin H(2) + A + H(2)O

Gene ontology

F:peroxidase activity
F:iron ion binding
P:response to oxidative stress
P:oxidation reduction
C:endoplasmic reticulum membrane
F:heme binding
C:microsome
F:oxidoreductase activity, acting on single d...
F:prostaglandin-endoperoxide synthase activity
P:prostaglandin biosynthetic process
C:nucleus
P:regulation of blood pressure

Tissue specificity

Expressed throughout the forebrain in discrete populations of neurons and is enriched in the cortex and hippocampus.

Fasta

>P35355 : length: 604
MLFRAVLLCAALALSHAANPCCSNPCQNRGECMSIGFDQYKCDCTRTGFYGENCTTPEFL
TRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRNSIMRYVLTSRSHLIDSPPTYNVHY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDPQGT
NMMFAFFAQHFTHQFFKTDQKRGPGFTRGLGHGVDLNHVYGETLDRQHKLRLFQDGKLKY
QVIGGEVYPPTVKDTQVDMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
ILKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIASEFNTLYHWHPLLPDTFNIEDQEYTFKQFLYNNSILLEHGLAHFVESFTRQIAGRV
AGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKAL
YHDIDAMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEV
GFRIINTASIQSLICNNVKGCPFASFNVQDPQPTKTATINASASHSRLDDINPTVLIKRR
STEL



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min