Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Enzyme Number

1.1.1.205

RLRdb entry

RL00417

Organisms

Saccharomyces cerevisiae (Baker's yeast) (4932_fungi)

Synonyms

Putative inosine-5'-monophosphate dehydrogenase IMD1;
Short=IMP dehydrogenase;
Short=IMPDH;
Short=IMPD;
EC=1.1.1.205;

Key words

CBS domain, Complete proteome, GMP biosynthesis, Metal-binding, NAD, Oxidoreductase, Phosphoprotein, Potassium, Purine biosynthesis, Repeat

Links to iHOP

P39567

Catalytic activity

Inosine 5'-phosphate + NAD(+) + H(2)O = xanthosine 5'-phosphate + NADH

Gene ontology

F:potassium ion binding
P:oxidation reduction
P:GMP biosynthetic process
F:IMP dehydrogenase activity

Fasta

>P39567 : length: 403
MAAIRDYKTALDLTKSLPRPDGLSVQELMDSKIRGGLAYNDFLILPGLVDFASSEVSLQT
KLTRNITLNIPLVSSPMDTVTESEMATFMALLDGIGFIHHNCTPEDQADMVRRVKNYENG
FINNPIVISPTTTVGEAKSMKEKYGFAGFPVTADGKRNAKLVGAITSRDIQFVEDNSLLV
QDVMTKNPVTGAQGITLSEGNEILKKIKKGRLLVVDEKGNLVSMLSRTDLMKNQKYPLAS
KSANTKQLLWGASIGTMDADKERLRLLVKAGLDVVILDSSQGNSIFQLNMIKWIKETFPD
LEIIAGNVVTKEQAANLIAAGADGLRIGMGTGSICITQKVMACGRPQGTAVYNVCEFANQ
FGVPCMADGGVQKHWSYYYQSFGSWFFYCYDGWYVGRYYRITR



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min