Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Enzyme Number

1.1.1.205

RLRdb entry

RL00417

Organisms

Saccharomyces cerevisiae (Baker's yeast) (4932_fungi)

Synonyms

Probable inosine-5'-monophosphate dehydrogenase IMD3;
Short=IMP dehydrogenase;
Short=IMPDH;
Short=IMPD;
EC=1.1.1.205;

Key words

CBS domain, Complete proteome, GMP biosynthesis, Metal-binding, NAD, Oxidoreductase, Potassium, Purine biosynthesis, Repeat

Links to iHOP

P50095

Catalytic activity

Inosine 5'-phosphate + NAD(+) + H(2)O = xanthosine 5'-phosphate + NADH

Gene ontology

P:GTP biosynthetic process
F:potassium ion binding
C:cytoplasm
F:protein binding
P:oxidation reduction
P:GMP biosynthetic process
F:IMP dehydrogenase activity

Fasta

>P50095 : length: 523
MAAVRDYKTALEFAKSLPRLDGLSVQELMDSKTRGGLTYNDFLVLPGLVDFPSSEVSLQT
KLTRNITLNTPFVSSPMDTVTESEMAIFMALLGGIGFIHHNCTPEDQADMVRRVKNYENG
FINNPIVISPTTTVGEAKSMKERFGFSGFPVTEDGKRNGKLMGIVTSRDIQFVEDNSLLV
QDVMTKNPVTGAQGITLSEGNEILKKIKKGKLLIVDDNGNLVSMLSRTDLMKNQNYPLAS
KSATTKQLLCGAAIGTIDADKERLRLLVEAGLDVVILDSSQGNSIFQLNMIKWIKETFPD
LEIIAGNVATREQAANLIAAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVCEFANQ
FGIPCMADGGVQNIGHITKALALGSSTVMMGGMLAGTTESPGEYFYQDGKRLKAYRGMGS
IDAMQKTGTKGNASTSRYFSESDSVLVAQGVSGAVVDKGSIKKFIPYLYNGLQHSCQDIG
YKSLTLLKENVQSGKVRFEFRTASAQLEGGVHNLHSYEKRLHN



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min