Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Enzyme Number

2.4.2.14

RLRdb entry

RL00276

Organisms

Homo sapiens (Human) (9606_human)

Synonyms

Amidophosphoribosyltransferase;
Short=ATase;
EC=2.4.2.14;
Glutamine phosphoribosylpyrophosphate amidotransferase;
Short=GPAT;
Flags: Precursor;

Key words

4Fe-4S, Allosteric enzyme, Glutamine amidotransferase, Glycosyltransferase, Iron, Iron-sulfur, Magnesium, Metal-binding, Purine biosynthesis, Transferase

Links to iHOP

Q06203

Catalytic activity

5-phospho-beta-D-ribosylamine + diphosphate + L-glutamate = L-glutamine + 5-phospho-alpha-D-ribose 1-diphosphate + H(2)O

Gene ontology

P:nucleoside metabolic process
F:4 iron, 4 sulfur cluster binding
F:iron ion binding
F:amidophosphoribosyltransferase activity
P:purine base biosynthetic process
P:purine nucleotide biosynthetic process
F:magnesium ion binding
P:glutamine metabolic process

Tissue specificity

Ubiquitously expressed.

Fasta

>Q06203 : length: 517
MELEELGIREECGVFGCIASGEWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPT
FKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVA
HNGELVNAARLRKKLLRHGIGLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEA
PTAYSLLIMHRDVIYAVRDPYGNRPLCIGRLIPVSDINDKEKKTSETEGWVVSSESCSFL
SIGARYYREVLPGEIVEISRHNVQTLDIISRSEGNPVAFCIFEYVYFARPDSMFEDQMVY
TVRYRCGQQLAIEAPVDADLVSTVPESATPAALAYAGKCGLPYVEVLCKNRYVGRTFIQP
NMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASP
PIKYPCFMGINIPTKEELIANKPEFDHLAEYLGANSVVYLSVEGLVSSVQEGIKFKKQKE
KKHDIMIQENGNGLECFEKSGHCTACLTGKYPVELEW



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min