Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Enzyme Number

1.14.99.1

RLRdb entry

RL00448

Organisms

Rattus norvegicus (Rat) (10116_rodents)

Synonyms

Prostaglandin G/H synthase 1;
EC=1.14.99.1;
Cyclooxygenase-1;
Short=COX-1;
Prostaglandin-endoperoxide synthase 1;
Prostaglandin H2 synthase 1;
Short=PGH synthase 1;
Short=PGHS-1;
Short=PHS 1;
Flags: Precursor;

Key words

Dioxygenase, EGF-like domain, Endoplasmic reticulum, Fatty acid biosynthesis, Glycoprotein, Heme, Iron, Lipid synthesis, Membrane, Metal-binding, Microsome, Oxidoreductase, Peroxidase, Prostaglandin biosynthesis, Signal

Links to iHOP

Q63921

Function

May play an important role in regulating or promoting cell proliferation in some normal and neoplastically transformed cells.

Subcellular localization

Microsome membrane; Peripheral membrane protein. Endoplasmic reticulum membrane; Peripheral membrane protein

Catalytic activity

Arachidonate + AH(2) + 2 O(2) = prostaglandin H(2) + A + H(2)O

Gene ontology

F:peroxidase activity
F:iron ion binding
P:response to oxidative stress
P:oxidation reduction
C:endoplasmic reticulum membrane
F:heme binding
C:microsome
F:oxidoreductase activity, acting on single d...
F:prostaglandin-endoperoxide synthase activity
P:prostaglandin biosynthetic process
C:nucleus
P:regulation of blood pressure

Fasta

>Q63921 : length: 602
MSRRSLSLQFPLLLLLLLLPPPPVLLTDAGVPSPVNPCCYYPCQNQGVCVRFGLDHYQCD
CTRTGYSGPNCTIPEIWTWLRSSLRPSPSFTHFLLTHGYWIWEFVNATFIREVLMRLVIT
VRSNLIPSPPTYNTAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDIHLLA
QRLLLRREFIPGPQGTNVLFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDSL
ERQYHLRLFKDGKLKYQVLDGEVYPPSVEQASVLMRYPPGVPPEKQMAVGQEVFGLLPGL
MLFSTIWLREHNRVCDLLKEEHPTWDDEQLFQTTRLILIGETIKIIIEEYVQHLSGYFLQ
LKFDPELLFRAQFQYRNRIALEFNHLYHWHPLMPDSFQVGSQEYSYEQFLFNTSMLVDYG
VEALVDAFSRQRAGRIGGGRNFDYHVLHVAEDVIKESREMRLQSFNEYRKRFGLKPYTSF
QEFTGEKEMAAELEELYGDIDALEFYPGLMLEKCQPNSLFGESMIEMGAPFSLKGLLGNP
ICSPEYWKPSTFGGDVGFNIVNTASLKKLVCLNTKTCPYVSFRVPDYPGDDGSVFVRPST
EL



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min