Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Enzyme Number

2.7.1.91

RLRdb entry

RL00415

Organisms

Mus musculus (Mouse) (10090_rodents)

Synonyms

Sphingosine kinase 1;
Short=SPK 1;
Short=SK 1;
EC=2.7.1.91;

Key words

Alternative splicing, ATP-binding, Calmodulin-binding, Kinase, Nucleotide-binding, Phosphoprotein, Transferase

Links to iHOP

Q8CI15

Function

Catalyzes the phosphorylation of sphingosine to form sphingosine 1-phosphate (SPP), a lipid mediator with both intra- and extracellular functions. Also acts on D-erythro-sphingosine and to a lesser extent sphinganine, but not other lipids, such as D, L-threo-dihydrosphingosine, N, N-dimethylsphingosine, diacylglycerol, ceramide, or phosphatidylinositol (By similarity).

Catalytic activity

ATP + sphinganine = ADP + sphinganine 1-phosphate
ATP + sphingosine = ADP + sphingosine 1-phosphate

Gene ontology

P:brain development
P:positive regulation of cell proliferation
F:diacylglycerol kinase activity
F:sphinganine kinase activity
F:ATP binding
F:D-erythro-sphingosine kinase activity
P:inflammatory response
P:activation of protein kinase C activity
F:magnesium ion binding
P:blood vessel development
F:calmodulin binding
P:regulation of interleukin-1 beta production

Fasta

>Q8CI15 : length: 382
MEPVECPRGLLPRPCRVLVLLNPQGGKGKALQLFQSRVQPFLEEAEITFKLILTERKNHA
RELVCAEELGHWDALAVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPGGSGNALAASV
NHYAGYEQVTNEDLLINCTLLLCRRRLSPMNLLSLHTASGLRLYSVLSLSWGFVADVDLE
SEKYRRLGEIRFTVGTFFRLASLRIYQGQLAYLPVGTVASKRPASTLVQKGPVDTHLVPL
EEPVPSHWTVVPEQDFVLVLVLLHTHLSSELFAAPMGRCEAGVMHLFYVRAGVSRAALLR
LFLAMQKGKHMELDCPYLVHVPVVAFRLEPRSQRGVFSVDGELMVCEAVQGQVHPNYLWM
VCGSRDAPSGRDSRRGPPPEEP



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min