Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Enzyme Number

2.7.1.48

RLRdb entry

RL00407

Organisms

Rattus norvegicus (Rat) (10116_rodents)

Synonyms

Uridine-cytidine kinase 2;
Short=UCK 2;
EC=2.7.1.48;
Uridine monophosphokinase 2;
Cytidine monophosphokinase 2;

Key words

ATP-binding, Kinase, Nucleotide-binding, Transferase

Links to iHOP

Q9QYG8

Function

Phosphorylates uridine and cytidine to uridine monophosphate and cytidine monophosphate. Does not phosphorylate deoxyribonucleosides or purine ribonucleosides. Can use ATP or GTP as a phosphate donor. Can also phosphorylate cytidine and uridine nucleoside analogs such as 6-azauridine, 5-fluorouridine, 4-thiouridine, 5-bromouridine, N(4)-acetylcytidine, N(4)-benzoylcytidine, 5-fluorocytidine, 2-thiocytidine, 5-methylcytidine, and N(4)-anisoylcytidine (By similarity).

Catalytic activity

ATP + cytidine = ADP + CMP
ATP + uridine = ADP + UMP

Gene ontology

P:metabolic process
F:phosphotransferase activity, alcohol group ...
F:uridine kinase activity
F:ATP binding

Fasta

>Q9QYG8 : length: 261
MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYHQKQVVILS
QDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELIFKTLKEITEGKTVQIPVYDFVSHSRK
EETVTIYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQ
ILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGLSKRQTNG
YLNGYTPSRKRQASESSSRPH



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min